KEGG   Leisingera aquaemixtae: R2C4_04270Help
Entry
R2C4_04270        CDS       T06085                                 

Definition
(GenBank) formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
laqu  Leisingera aquaemixtae
Pathway
laqu00670  One carbon pool by folate
laqu01100  Metabolic pathways
laqu01120  Microbial metabolism in diverse environments
laqu01200  Carbon metabolism
Module
laqu_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:laqu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    R2C4_04270
Enzymes [BR:laqu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     R2C4_04270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS Nas2_N
Motif
Other DBs
NCBI-ProteinID: QDI75009
Position
530055..531731
Genome map
AA seq 558 aa AA seqDB search
MSYKSDIEIARDAQKKPIQEIGAKIGISNDDLLPYGHDKAKVSQRFINSVQDREDGKLIL
VTAINPTPAGEGKTTTTVGLGDGLNRIGKNAMICIREASLGPNFGMKGGAAGGGYAQVVP
MEEMNLHFTGDFHAITSAHSLLSAMIDNHIYWGNECEIDVRRVAWRRVVDMNDRALRQIT
ASLGGVSNGFPRETGFDITVASEVMAILCLANDLKDLEQRLGDIIVAYRRDRTPVYCRDI
KAEGAMTVLLKDAMQPNLVQTLENNPAFVHGGPFANIAHGCNSVIATKTALKVADYVVTE
AGFGADLGAEKFMNIKCRKAGIAPSAVVVVATVRAMKMNGGIAKADLGAENVDAVNKGCA
NLGRHIENVKSFGVPVVVAINHFVTDTEAEVQAVKDYCGSHGVEAVLSRHWELGSEGSAD
LAQKVVELADSGKANFSPIYPDAMPLFEKIETIAKRIYRADEVLADQKIRNQLKEWEEAG
YGNLPVCMAKTQYSFTTDPNRRGAPVGHSVPVREVRLSAGAGFIVVVCGEIMTMPGLPRT
PAAETIRLNADGQIEGLF
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgagctacaagagtgacattgagatcgcgcgggacgcgcagaagaagccgatccaggag
attggtgcgaagatcgggatttccaatgacgatctgctgccctacggccacgacaaggcg
aaggtgagccagcggttcatcaactcggtgcaggaccgcgaagacggcaagctgatcctg
gtgaccgcgatcaacccgacgcctgcgggcgaaggcaagaccaccaccaccgtgggcctg
ggcgacgggctgaaccggatcggcaaaaacgcgatgatctgtatccgcgaagcctcgctg
gggccgaacttcggcatgaagggcggcgctgcgggcggcggctatgcccaggtggtgccg
atggaggagatgaacctccatttcaccggcgacttccacgccatcacctcggcgcattcg
ctgctgtcagccatgatcgacaaccacatctactggggcaacgagtgcgagatcgacgtg
cgccgcgtcgcctggcgccgggtggtcgacatgaacgaccgggcgctgcgccagatcacc
gcctcgctcggcggcgtctccaacggcttcccgcgcgagaccggctttgacatcaccgtg
gcctcggaagtgatggcgatcctgtgcctggccaatgacctcaaggacctggaacagcgc
ctgggcgacatcatcgtggcctaccgccgcgaccggaccccggtctactgccgcgacatc
aaggccgagggcgcgatgaccgtgcttctgaaggacgcgatgcagccgaacctggtgcag
accctggaaaacaacccggccttcgtgcacggcggcccgtttgccaacatcgcgcatggc
tgcaactcggtcatcgccaccaagaccgccctgaaagtggccgactacgtggtcaccgag
gcgggtttcggggccgacctcggcgccgagaagttcatgaacatcaagtgccgcaaggcg
ggcatcgcgccgtcggcggtggtggtcgtggccaccgtgcgggcgatgaagatgaacggc
ggcatcgccaaggcggacctgggcgcggaaaacgtcgatgcggtcaacaagggctgcgcc
aacctcggccgccacatcgaaaacgtcaaatccttcggcgtgccggtggtggttgcgatc
aaccacttcgtgaccgacaccgaggccgaggtgcaggcggtgaaggactactgcggcagc
catggcgtcgaagcggtgctgtcgcgccactgggagctgggctccgaaggctctgccgat
ctggcgcagaaggtggttgagctggccgactccggcaaggcgaacttctcgccgatctac
ccggacgccatgccgctgtttgagaagatcgagaccatcgccaagcgcatctaccgcgcc
gacgaggtgctggccgatcagaagatccgcaatcagctgaaggaatgggaagaggcgggc
tatggcaacctgccggtctgtatggcaaaaacccagtactccttcaccaccgacccgaac
cgccgcggcgcgcccgtgggccattcggtgccggtgcgcgaagtgcggctttcggccggt
gcgggcttcatcgtggtggtctgcggcgagatcatgacgatgccgggcctgccgcgcacc
ccggcggcggagaccatccgcctgaatgcggacggccagatcgaaggcctgttctga

DBGET integrated database retrieval system