KEGG   Leisingera aquaemixtae: R2C4_18815Help
Entry
R2C4_18815        CDS       T06085                                 

Definition
(GenBank) mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase
  KO
K16011  mannose-1-phosphate guanylyltransferase / mannose-6-phosphate isomerase [EC:2.7.7.13 5.3.1.8]
Organism
laqu  Leisingera aquaemixtae
Pathway
laqu00051  Fructose and mannose metabolism
laqu00520  Amino sugar and nucleotide sugar metabolism
laqu01100  Metabolic pathways
laqu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:laqu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    R2C4_18815
   00520 Amino sugar and nucleotide sugar metabolism
    R2C4_18815
Enzymes [BR:laqu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     R2C4_18815
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.8  mannose-6-phosphate isomerase
     R2C4_18815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MannoseP_isomer NTP_transferase Cupin_2 Cupin_1 Glyoxalase_3
Motif
Other DBs
NCBI-ProteinID: QDI77700
Position
complement(3483794..3485242)
Genome map
AA seq 482 aa AA seqDB search
MLITPILLCGGSGTRLWPLSRKSYPKQFVPLMGEETLFQASARRLSGQTDQLRFAAPMVL
TNSDFRFIVTEQLQAIGIDPGAVLIEPEGRNTAPAVLAAALRAQAEDPDAVLLVAPSDHV
VPDTAAFHAAVAKGLEAVAQGQMVTFGITPAHAETAYGYLELAAAPEAGNAPVPLKQFVE
KPDAARAAEMLAAGNFKWNAGIFLFRAADVIAAFKTHAPALMEPVQAALDQAKTDLGFLR
LAAEPWSRAEDISIDYAVMEKAENLSVVPFDAAWSDLGGWDAVWRESGPDATGVVTSGGA
TAIDCRDTLLRADSERLEVVGIGLDGIIAVAMNDAVLVADKSRAQDVKKALTALKQKGAA
QATQFPKDHRPWGWFESLVVGDRFQVKRIQVHPGASLSLQSHLHRSEHWIVVKGTAKVTV
NDEVKLVTENQSVYVPLGAVHRMENPGKVPMVLIEVQTGAYVGEDDIVRYEDVYARGQGE
KG
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgttgattaccccaatcctcctgtgcggagggtccggaacccgcctgtggccgctgtcg
cgcaaaagctatcccaagcaattcgtgcccctgatgggggaagagaccctgtttcaggcc
tccgcccggcggctgtcggggcagacggatcagctcaggtttgccgcgccgatggtgctg
accaattccgatttccgcttcatcgtcaccgagcagctgcaggccatcggcatcgacccc
ggcgccgtcctgatcgagccggaggggcgcaacaccgcgcctgccgtgctggccgcggcc
ctgcgcgcccaggccgaagaccccgatgcggtgctgctggtggcgccctcggaccacgtg
gtgccggacaccgcagccttccacgccgctgtcgccaagggcctcgaagcggtggcccag
ggccagatggtgacctttggcatcacccctgcccatgccgaaaccgcctatggctatctg
gagcttgctgccgcgccagaggccgggaacgccccggttccgcttaagcagtttgtcgaa
aaacccgatgccgcgcgcgccgctgaaatgctggcagcgggcaacttcaaatggaacgcg
gggatcttcctgttccgcgccgcggatgtcatcgccgccttcaaaacacatgcgccggcg
ctgatggagccggtgcaggcagcgctggatcaggccaagacagacctcggctttctgcgc
ctggcggcagagccctggagccgtgccgaggacatctccattgactatgcggtgatggaa
aaggccgaaaacctctcagtcgtgccttttgacgcggcctggtcggaccttggcggctgg
gatgcggtctggcgcgaaagcggcccggacgcaaccggcgttgtcaccagcggcggcgcc
accgcgattgactgccgggacacgctcctgcgtgccgacagcgaacggctggaggttgtc
ggcatcgggctggacggcataatagcggtggcgatgaatgacgcggtgctggttgccgac
aaatcccgcgcccaggatgtgaaaaaggcccttaccgcgctgaagcaaaagggcgcggct
caggccacccagttccccaaggaccaccgcccctggggctggttcgagagcctggtggtt
ggcgaccggttccaggtcaagcggatccaggtgcatcccggcgcgtcgctgtcactgcaa
agccacctgcaccgctctgagcactggatcgtggtgaagggcactgccaaggtaacggtg
aatgacgaggtgaaactggtgacggaaaaccaaagcgtctacgtcccgcttggcgccgtc
caccggatggaaaaccccggcaaggtgccgatggtgctgatcgaggttcagaccggcgcc
tatgtcggcgaggacgacattgtgcgctatgaagatgtctacgcgcggggacagggcgaa
aagggctga

DBGET integrated database retrieval system