KEGG   Candidatus Liberibacter americanus: lam_038Help
Entry
lam_038           CDS       T02902                                 

Gene name
rimK
Definition
(GenBank) Glutathione synthase/Ribosomal protein S6 modification enzyme
  KO
K01920  glutathione synthase [EC:6.3.2.3]
Organism
lar  Candidatus Liberibacter americanus
Pathway
lar00270  Cysteine and methionine metabolism
lar00480  Glutathione metabolism
lar01100  Metabolic pathways
Module
lar_M00118  Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:lar00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    lam_038 (rimK)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    lam_038 (rimK)
Enzymes [BR:lar01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     lam_038 (rimK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSH-S_ATP GSH-S_N RimK ATPgrasp_YheCD ATPgrasp_ST ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: AHA27422
UniProt: U6B6P9
Position
43235..44197
Genome map
AA seq 320 aa AA seqDB search
MKKIVNIAIQMDHISTINVTTDSTFAITLEAQVRGYNLFHYTPDQLYMRDNKVFANAEPM
SLRDNKQDYYYLAKKEIIDLSQMDVVLIRQDPPFNMNYISSTYLLDKINTKTLIINNPFW
IRNSPEKIFVTEFIELTPPTLISRDITQIVKFYSEIKDVIIKPLYGNGGEGIFRINQGDR
NLYSLIEMLLSRYPEPLIVQLYLPQVRNGDKRILLLNGKPVGAINRIPSESENRSNIHVG
GKAELSELTNAENNICRRIGPILQERGLFFTGIDVIGDYITEINVTSPTCIREIHKLGGD
NIASLFWDKVETLFETLIKK
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattgtaaatatagcaattcagatggatcatatatctaccatcaacgtgaca
acagattcaacttttgcaataacattagaagcgcaagtacgtggttataatttattccat
tatacaccagatcagctttatatgcgtgataataaggtttttgcaaatgcagaaccaatg
tctttacgtgacaataaacaagactattactatcttgcaaaaaaagagataattgatctt
tctcaaatggatgtagttctcatccgccaagatccaccgtttaatatgaattatattagc
agcacttaccttttggataaaataaatacgaaaacattgataataaataatccgttttgg
atacgaaattctccagaaaaaatttttgttacagaatttattgaactaacccctccaact
ctaatttcacgagatattactcaaatagttaaattctactcagagattaaggatgtaatt
attaaacctttatatggcaacggaggagaaggaatttttcgtataaatcaaggagataga
aatttatattctttaatcgaaatgctattatcacgatatcctgagccattgattgtccaa
ttatatttgccacaagttcgaaatggggataaacgcattcttctgttgaacggcaaacca
gttggagcaattaatagaataccctctgaaagtgaaaatcgatcaaatatccacgtaggc
ggcaaagcagaactttcagaactaacaaacgcagaaaataatatttgtcgtcgcatcgga
ccaatactgcaagaacgaggtttgttttttacaggcattgatgtaatcggcgattatata
acagaaattaacgttacttcaccaacttgtatacgtgagattcataaactagggggagat
aacatagcatctcttttttgggataaagttgaaacactatttgaaactttaataaagaaa
taa

DBGET integrated database retrieval system