KEGG   Candidatus Liberibacter americanus: lam_202Help
Entry
lam_202           CDS       T02902                                 

Gene name
glyQ
Definition
(GenBank) Glycyl-tRNA synthetase, alpha subunit
  KO
K01878  glycyl-tRNA synthetase alpha chain [EC:6.1.1.14]
Organism
lar  Candidatus Liberibacter americanus
Pathway
lar00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:lar00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    lam_202 (glyQ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:lar01007]
    lam_202 (glyQ)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:lar03016]
    lam_202 (glyQ)
Enzymes [BR:lar01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.14  glycine---tRNA ligase
     lam_202 (glyQ)
Amino acid related enzymes [BR:lar01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   lam_202 (glyQ)
Transfer RNA biogenesis [BR:lar03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    lam_202 (glyQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2e N-glycanase_C
Motif
Other DBs
NCBI-ProteinID: AHA27575
UniProt: U6B3Q3
Position
complement(240235..241158)
Genome map
AA seq 307 aa AA seqDB search
MKPVNDKKDNLSFQDIILILTKYWSEQGCTILQPYDMEVGAGTFHPSTTLRTLGPRPWSV
AYVQPSRRPSDGRYAQNPNRLQHYYQFQVIIKPNPPNLQQLYIESLKAIGINPLLHDIRF
VEDNWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQN
VNNVYNIIFNEAAGKKILYRDIFYQSEQEYSRYNFEYANTKVLHSHFIDHEKECLDILDA
GSSNNHQNYHSCVFPAYDQCIKASHIFNLLDARGAISTTERQRYILRIRALAKACGEAFL
TTDSGAL
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaccagttaatgacaaaaaagataacctgtcctttcaagatataatattaattttg
acgaaatattggtcagaacagggttgcactattttacagccttacgatatggaagtggga
gcaggaacctttcatccatcaacaactttgcgcacactaggtccacgcccttggagcgtg
gcgtatgttcagccttcgcgtagaccatcagatggtcgttatgctcagaatccaaaccgt
ttacaacactattatcaatttcaggttataataaagcctaatccgcctaatttacaacaa
ttgtatatagaatctcttaaagccatcggcataaatccactgcttcatgatattcgtttt
gttgaagataactgggaaagtccaaccctcggagcttggggactaggatgggaatgttgg
tgcgatggaatggaaatatctcaattcacatatttccaacaagtctgcggcatagaatgt
tctccaatatctggagaaataacttatggcctagaaaggcttgctatgtatgttcaaaac
gtcaacaatgtatataatatcatttttaatgaagctgcaggaaaaaaaattctctacaga
gacatcttttatcaatctgaacaagagtattcaagatataattttgaatatgcaaataca
aaagttttacacagtcattttattgaccatgaaaaggaatgtttggatatattagatgca
ggttcttctaataatcatcaaaattatcattcatgtgtttttcctgcatatgatcaatgt
atcaaagcttctcatatatttaatcttttagacgcaagaggagcaatatctacaaccgaa
cgacaacgatatatacttcgaattagagctttggctaaagcatgtggggaagcgtttctc
acaacagatagcggagctctataa

DBGET integrated database retrieval system