KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_00020
Entry
CLIBASIA_00020    CDS       T00948                                 
Name
(GenBank) prophage antirepressor
Organism
las  Candidatus Liberibacter asiaticus psy62
SSDB
Motif
Pfam: Bro-N
Other DBs
NCBI-ProteinID: ACT56598
UniProt: C6XH53
Position
2285..3073
AA seq 262 aa
MSTITPFEFESNKIRTIVDKDQNIWFVAKDVATALGYENSNEAINAHCKGVAKRYPLKTE
GGIQKVRIISEPDVYRLLVKSTLPSAQKFERWVFEEVLPTLRKTGSYSVEAPKLRATSAS
TVLRVHKHLEELAKQAGLKDNQLLLKVNRGVTKITGVDQLEAMDIKHLPSSDNDEYLTIT
QIGERLNPPQRARFLNKLLLKRGLQVSKVSGGYRPTPKGEERGGKMCDVPMQHVEGSTQQ
LKWNSNLLVSFLQNELINTPRL
NT seq 789 nt   +upstreamnt  +downstreamnt
atgagcactataaccccttttgaatttgaaagcaacaagatccgtactattgtggataaa
gaccagaatatatggtttgtggctaaagatgtcgctacggctttagggtatgaaaattca
aatgaagcaataaacgctcattgcaagggggtagcaaaacgctacccccttaagactgaa
ggcggaatacaaaaagtccgtatcatatcagaacctgatgtttacaggttactggttaaa
agcacgttaccatcagcacagaagtttgagcgttgggtatttgaggaggtgttacctact
cttcgcaaaacaggcagttattcggttgaagcaccgaagcttagagccacttcagcgagt
acagttttaagagttcacaaacatcttgaagaactagccaagcaagcaggattaaaagac
aatcaacttttgttgaaggttaaccgaggcgttacgaagataacaggtgttgatcagtta
gaggctatggatatcaaacacctaccctcttccgataacgacgaatatttaacaattacc
caaataggggaaaggcttaacccacctcagagagcgagatttttaaacaaacttcttctt
aagcgaggactgcaagttagcaaggtctcaggtggctatagaccgacacctaaaggtgaa
gagcgtggaggcaagatgtgtgatgtgcccatgcagcatgttgaaggctcaacccagcaa
ttaaaatggaattcgaatttactcgtttcgtttcttcaaaacgaattaattaacacacca
cgcctataa

DBGET integrated database retrieval system