KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_00025Help
Entry
CLIBASIA_00025    CDS       T00948                                 

Definition
(GenBank) hypothetical protein
Organism
las  Candidatus Liberibacter asiaticus psy62
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2815
Motif
Other DBs
NCBI-ProteinID: ACT56599
UniProt: C6XH54
Position
3091..3741
Genome map
AA seq 216 aa AA seqDB search
MQKLTVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEI
FPNVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLL
VDRQAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASP
KSDTSEFKDYGEEQDSDTSVSNFASAEVDSDALPWN
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaactaactgtaaaaggacgtctatcataccctgctcttgatacgaaggtgcgt
atgaagctccctgatggctcaagtgttgagcactacggctgtgatatcgtctttccgaaa
gcggatacgaagcagattaacgctgttgaggcgtgtttaaagaccgctgttaccgagata
tttccgaatgtctctccggatgcgtttttgtcggcggttcgaagcaaatcggaatcccgt
ggggttttgagggacggcgatgcgaagatcgcttcttctcacaagcctgagaattacaca
caaacatacacagacagcgtgtatatctcggcgaagaacaaatatgttcaaccgttactc
gtggatcgtcaagcgcaacctgtgagcgatccgagggaggttttttatccggggtgttgg
gtcattgcgaagcttaacatcggggcgtatgagcttgatccgtacaaaaccaagggtttc
agttgcacgctaacgggcgttcagttcttcaagcatgatgagcgttggggtgcttccccg
aaatcggacacttcggagtttaaggattacggcgaagagcaagactccgatacctcggtc
tcaaactttgcctcagcggaggtggactccgacgctctgccgtggaactga

DBGET integrated database retrieval system