KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_00030Help
Entry
CLIBASIA_00030    CDS       T00948                                 

Definition
(GenBank) putative DNA polymerase from bacteriophage origin
  KO
K02334  DNA polymerase bacteriophage-type [EC:2.7.7.7]
Organism
las  Candidatus Liberibacter asiaticus psy62
Brite
KEGG Orthology (KO) [BR:las00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CLIBASIA_00030
Enzymes [BR:las01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     CLIBASIA_00030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol_A DNA_pol_A_exo1
Motif
Other DBs
NCBI-ProteinID: ACT56600
UniProt: C6XH55
Position
3745..5772
Genome map
AA seq 675 aa AA seqDB search
MSKLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQY
LRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFSE
HLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRLIPL
SDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQTYA
LRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSEAVS
SDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGETIADPLGLA
SDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTP
IDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQAES
HHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGGSISA
RRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYLNTATSQLMRERTYGGKLTEN
IVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKG
LPLKAEGYEAKRYRK
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaagctgtttatcgacattgaaacccgcagtcctcaacccttgcctaaggtaggg
gtttgggcttatgcggagcaggcggttatcactttatgtgcgtatgcatgggacgatgaa
cctgtgaagttgtgggataggactgaacaatctgctatgccatcggatcttctgcagtac
ttaagagatgaaacggtgatgtgtgttgcacacaatagtctgtttgaacggatactgttt
aagaagacattaggtattgatattccatctaaacgttggatttgtacgagtgttttagcc
cgcacgaatggtttaccctcttcgttgaaaaacgcttgtttagcactaaatttttctgaa
catttaaccaaaatggaagaaggaaaagctcttatcgctcgtttttgcaagggatcgatt
gattcccctccgtatgactgtactcgtgctaatcacgttcaagcatggcagttatttggg
gagtactgcaaacgagacgttgaagccactagagagttatttaagcgacttattccttta
tctgatggggaaagggatttatggcttttagatcaaacgattaatgatcggggctacagg
atagacttagatttagttttgaagcttcaagagctcatagcccaagagcgtaagaagtta
gatgaagatatcgttaaattgacagatggtattatacgctcttctcgtcaaacgtatgct
ttaaggatgtacctatttcttataacgggaatagatttggttgatatgtcggagggtact
ttaaagtctattctgtctcattctaacatcactcaattggctaaagacctgattttgaac
cgcttagcatcatcgggatcagcaattttaaaactcaacactttatctgaggctgttagt
tctgatgggcgtcttcgagggactttacagttttatggtgcgagcagaacgggtcgatgg
tctggatgtgtgtttcaacctcagaatcttcctcgtcaagagcgatcggaggaaatattg
acacagactattcaagctttaaatcgaggggaaactattgcagatccgttaggtttggct
agtgattgtgtccgttcttgcatcatagcctcaaatggcaaaaagcttgttgttgcggat
ttagcagggattgaagcccgggttttggcatggattgctggtgaagactggaaaatcaaa
gcttttgcaaatggtgaagacatctatgttacaacttatgctaaagcgtttaacaccccc
attgacaaagtgagtaaagaacaaagagctattgggaaagttatggaattagccttaggg
tatcaaggtggggctaaggtgtttaagacaatggcatctcattgtggattagatctacaa
cagtttagtcagaatgtcaaaagcacctcaacttttgaagattgggaacaagcggaatct
catcatctttggatgcaagatcaatatcccgaatttgcggtgaaggataaattgataggc
acggcttgtgaacttgttaaaaaggcttggcgggctaaacatcaaggtgttcttcaacta
tggaaggacttaaccgagggttttgcatgtgtagtgcaagaaggaggttcaatatctgct
cgaagggttgcgaatgttccccgtcttgtgatgaggaggcacaaacgagacgttcacatt
gttttaccttcatcaagaaggcttgtttacagtgatgtaaagggcgattgttcttatctc
aatactgccacttcacagctcatgagagagagaacgtatggtggcaagctaacagagaat
attgttcaagccatcagtagggatatcctttgcgagggcatgaaaaacgctactaaaaat
ggctatgacatagttttaacggttcatgatgagattgttagtgaaactcctgatactcct
tactttagcgttgggaccttatgttctttgatgacaaaaaatcccagttgggcaaaaggt
ttgcccctcaaagcagaaggttatgaagcgaaaaggtatcgcaaatga

DBGET integrated database retrieval system