KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_00085Help
Entry
CLIBASIA_00085    CDS       T00948                                 

Definition
(GenBank) ABC transporter
  KO
K02066  phospholipid/cholesterol/gamma-HCH transport system permease protein
Organism
las  Candidatus Liberibacter asiaticus psy62
Pathway
las02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:las00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    CLIBASIA_00085
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:las02000]
    CLIBASIA_00085
Transporters [BR:las02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   gamma-Hexachlorocyclohexane transporter
    CLIBASIA_00085
   Phospholipid transporter
    CLIBASIA_00085
   Mce system transporter
    CLIBASIA_00085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MlaE STAS STAS_2
Motif
Other DBs
NCBI-ProteinID: ACT56611
UniProt: C6XH66
Position
15442..16563
Genome map
AA seq 373 aa AA seqDB search
MSENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMY
FMEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVK
FINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGA
VIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEE
IDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSR
FHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIII
DSLFAIFYFAIGI
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgtcagagaatgggataactgtgttccgctttgctggaaattggaaatcaccagaaatt
tctgaaatagccgacgatgtggtaatggctataaataaatctatacaaagcgactctgcg
atagttgatctttcggcaattacggaaatcgacaccataggagctgaacttatcatgtac
ttcatggagaagtatcatggaaaaataaaattgcaaggagttagtacacacattgaacaa
ttattttctctaatctcttttactcacagaaaaaagataaaaaatcaaaaaccacaaaga
tcctttttttataatagttttaaaaatcttcactaccatattggcaagaagattgtgaaa
ttcattaatgattcttgcagtcaggcacatattttaggcttggtcattagcaatacagga
gaattctgcgctagcagttataaattcaagggatttctcctttctctgatcagacaaatg
tattacgtgggcgtcagcggagtgccagtagtgatccttatatcttttgtaactggcgca
gtaattgcacaacaaggagcatttcaactcagtcaatttggagcagaaattttttcgatc
gacttgatgagcatcctccaattacgcgaaataggagtattgctcacagcagttatgatt
gctggacgttctggaagtgccattgtagccgaaattggatctatgaaaattaatgaagaa
attgatgctatcagaacaatgggactagacttcgttagaatcctgatatcaccacgaatt
tgggcccttatcatttcattgccattactaactatcctagctaatttctccgctattatt
ggagcgtctatagtcatttggaaatactatgatattccttttgctgtatttttctcacga
tttcattcaacagcaacattggcaaatattttcacaggattgatcaaagcacccttcatg
gcatgtgccatcggtatagttgcaatgaaagaaggatttgcagtaggagtacattctaac
tctcttggcaaaaaagtgaccacttgcgttgtacaatcaatttctatagttattatcata
gattcactctttgcaattttctattttgcgatcggtatataa

DBGET integrated database retrieval system