KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_00230Help
Entry
CLIBASIA_00230    CDS       T00948                                 

Definition
(GenBank) ATP-dependent Clp protease ATP-binding subunit
  KO
K03694  ATP-dependent Clp protease ATP-binding subunit ClpA
Organism
las  Candidatus Liberibacter asiaticus psy62
Brite
KEGG Orthology (KO) [BR:las00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:las03110]
    CLIBASIA_00230
Chaperones and folding catalysts [BR:las03110]
 Heat shock proteins
  HSP100
   CLIBASIA_00230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_2 AAA_lid_9 AAA ClpB_D2-small AAA_5 Clp_N AAA_16 RuvB_N Sigma54_activat IstB_IS21 AAA_7 AAA_6 RNA_helicase AAA_18 AAA_3 TsaE ResIII TIP49 AAA_33
Motif
Other DBs
NCBI-ProteinID: ACT56636
UniProt: C6XH91
Position
complement(45136..47532)
Genome map
AA seq 798 aa AA seqDB search
MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL
LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS
HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD
LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA
IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL
YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ
KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI
DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY
GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM
SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM
DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL
NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA
RPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKSASSPIFFEIENSGSNISLET
EEKEVEDIKSDTDSLTIV
NT seq 2397 nt NT seq  +upstreamnt  +downstreamnt
ttgtcttttttttcagaaaaccttgaaaaagttttacaccaagcattagttttggctaat
gaaaggaatcacgaatatgcgacgttagagcatttgttgttggctttgattgatgattca
gatgcagcaatagtgatgctttcctgtaatgttgatcttaaggtattaaaaaacaacctg
ttgaactatatagataatgattcttccaataaattgaagaatggttttcgtgtggaatgc
aagcctacttctagttttcaaagggttgtacagcgagctgttcttcatgtccagtcgacc
ggtaggggcattgtgacaggtgctaacattcttgttgcacttttttctgagcctgatagt
catgctacgtattttttgcaagaacaagaaatgactttgtacgatgcagtcaactttatt
tcgcatggtataagtaaaaggaaagagtttgcaaattttcaatccaaattaaatgtagat
ggttcttctgctggttcagatggtgaaggttttgtgaatgattatcaagcgaaaacagac
cttaatcttttccctgccttgagtgcttactgtgtggatctaacggaaaaagtgaaaaaa
ggcaaagtagatattcttgttggtcggcatgaagaaattaatcgtactatacagatactt
tgtcggcgttcaaaaaataatccattgtatgttggtgatcctggggttggtaaaaccgct
atagctgaaggatttgctaagcagatcgtagatggcatggttccagatatcttattaggt
gcgagaattttttctttagatatgggaaatcttattgctggtacgcgttatcgaggtgat
ttcgaagaacgtattaagaagattgttaaagaaattgagtcttatgccaatgcgattctg
tatattgatgagatacacacgctggtcggagcaggatctgcttctggaatttctgtagat
gcttcgaaccttcttaagccggctttgtcttctggtgctgtccgttgtatagggtcaaca
acttatagtgaatatcgccagttttttgaaaaagataaagcattagtgcgtcgtttccaa
aagattgatgttagtgaaccgtcaattgaagatgcaattgaaattgttaagggaattaag
ccttatttcgaagagcatcatcaattgcgatattcaaaagaggcaatcagagcagcagta
caattgtcggtgcgccattttacttcccgtaaacttcccgataaagctatcgatgtcatt
gatgaagcgggtgcttcgcaaatattgcaacctttatcgaaaagaagaaaatttatcact
gagaaagatattaaaaaaacgattgcatcaatgaatcgtagtattcatacaaccagtttt
tctcgtgatgatgattctgttctcagtaatttagaaaaaaatctaggaacagttgtgtat
ggacaagaagaagcgattaagaagctttcttcttctattaagatagctcgagcgggtctt
tctgatccaaataagccaataggttgttatgtcttttctggtcctactggtgttggtaaa
acagaaataagcaaacagttggcgtttgctttgggagtacagcttctgcggtttgatatg
tcggaatatatggaacgtcatgctgtttctcgtctaattggggcacctcctggttatgta
ggtttcggtcaagggggaattttagctgattctgttgaccaaaatccatatagtgttgtt
ttactagatgaaattgaaaaatcgcatcctgatgttttaaatattttattgcagatcatg
gattatgggatattaactgatcaaagtggaaagaaaattagttttcgtaatgttattttg
attatgactactaatgctggtgctttagaaatgtctaaggcgaggataggttttggttca
tcgcgaaatgatgatgctgacaaagaggctttaaggaattttttatctcctgaatttttg
aatcgtctagattctattattcctttttttccattatcttcggatattattcgtcaagta
gtgcataagtttataatgaagttagagttgcagttgcaagaaaaggggatttcttttcat
ttttcggaagaagttattaattggcttgtcagtcatggttatgatgtgaaaatgggtgca
cgtcccttagaacgaataattaaagagcatgttaaggtaccactcgctgatgagatcctt
tttggaaaacttaaaaaaggaggaggagtcgtcaaggtttctttaaatcctgataagtct
gcttcatcgcctattttttttgagattgagaattctggctctaacatttctttggaaaca
gaagaaaaagaggtggaagatatcaagagtgatacggattctttgactattgtataa

DBGET integrated database retrieval system