KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_00240Help
Entry
CLIBASIA_00240    CDS       T00948                                 

Definition
(GenBank) hypothetical protein
Organism
las  Candidatus Liberibacter asiaticus psy62
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3126
Motif
Other DBs
NCBI-ProteinID: ACT56638
UniProt: C6XH93
Position
complement(48061..48276)
Genome map
AA seq 71 aa AA seqDB search
MEVRMRADEIKKLERYLKRVFGSGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISY
HFDMSILEDDL
NT seq 216 nt NT seq  +upstreamnt  +downstreamnt
atggaggtaagaatgcgcgctgatgaaattaaaaaattagagagatatcttaaaagagtt
tttggttctggtattgctgttcaatcacgggagaatcaatcagattcagttgaggtttta
atgaattcagaatttattggtctcgtttatcgtaatgatgatgaagaagaaatttcgtat
cattttgatatgtctattctagaagatgatctttga

DBGET integrated database retrieval system