KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_00260Help
Entry
CLIBASIA_00260    CDS       T00948                                 

Definition
(GenBank) hypothetical protein
Organism
las  Candidatus Liberibacter asiaticus psy62
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ACT56642
UniProt: C6XH97
Position
51202..51366
Genome map
AA seq 54 aa AA seqDB search
MCTPLMKKIFVENKKVFKGFKAQPLFLSFNIDGLFEKYLEIIQQLLSVIASYVE
NT seq 165 nt NT seq  +upstreamnt  +downstreamnt
ttgtgtacccccctaatgaaaaaaatatttgtagaaaataaaaaggtatttaaaggcttc
aaagcccaaccattatttttatcctttaatatcgacggtttatttgaaaaatatcttgaa
attatacaacaattgcttagtgtcatcgcatcatatgtagaataa

DBGET integrated database retrieval system