KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_00355Help
Entry
CLIBASIA_00355    CDS       T00948                                 

Definition
(GenBank) hypothetical protein
Organism
las  Candidatus Liberibacter asiaticus psy62
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ACT56661
UniProt: C6XHB8
Position
complement(73538..73648)
Genome map
AA seq 36 aa AA seqDB search
MYLYLDWYKTIIVSKGKVESFFIKNAFINGKMIFED
NT seq 111 nt NT seq  +upstreamnt  +downstreamnt
atgtatctttatcttgattggtataaaacaataatagtgtcgaagggaaaagttgaaagc
ttttttataaaaaatgcattcataaatggtaagatgatatttgaggattga

DBGET integrated database retrieval system