KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_00395Help
Entry
CLIBASIA_00395    CDS       T00948                                 

Gene name
rpmE
Definition
(GenBank) 50S ribosomal protein L31
  KO
K02909  large subunit ribosomal protein L31
Organism
las  Candidatus Liberibacter asiaticus psy62
Pathway
las03010  Ribosome
Brite
KEGG Orthology (KO) [BR:las00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    CLIBASIA_00395 (rpmE)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:las03011]
    CLIBASIA_00395 (rpmE)
Ribosome [BR:las03011]
 Ribosomal proteins
  Bacteria
   Large subunit
    CLIBASIA_00395 (rpmE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L31
Motif
Other DBs
NCBI-ProteinID: ACT56667
UniProt: C6XHC4
Position
83786..84010
Genome map
AA seq 74 aa AA seqDB search
MKKNIHPETHLITVVMTDGTQYQTRSTWKEEGAVMKLDIDPLSHFAWIGGRQKITDRGGQ
VSRFKKRFAGLSIE
NT seq 225 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaaatattcatccggaaactcaccttattacagtagtcatgactgatggaacg
caatatcaaactcgctctacttggaaagaagaaggagctgttatgaaactggacattgat
cctttgtcacattttgcttggattggtggaagacaaaagattactgatcgtggaggacaa
gtatcaagatttaaaaagcgtttcgctggcttatcaattgagtaa

DBGET integrated database retrieval system