KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_00460Help
Entry
CLIBASIA_00460    CDS       T00948                                 

Definition
(GenBank) hypothetical protein
Organism
las  Candidatus Liberibacter asiaticus psy62
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ACT56680
UniProt: C6XHD7
Position
97816..98112
Genome map
AA seq 98 aa AA seqDB search
MRHLILIMLLSILTTNIARAQVYHIHSPRIATKSSIHIKCHSCTLNKHHINKTPSSSSAV
YTKKEELIDGKKAMITTDNFMGGEPITFIKYLFEEDKK
NT seq 297 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcatttgattttaataatgcttttatccatactaaccactaatatagctagagct
caagtttatcatatccattcgcctcgtattgcaacaaaatcttcaatacatattaagtgt
catagttgcactctaaataaacatcatatcaataaaaccccttcatcttcttccgccgtg
tacaccaaaaaagaagaactaattgatgggaaaaaagcaatgatcacaacagataatttt
atgggaggtgaacctataacttttatcaaatatttatttgaagaagataaaaaatag

DBGET integrated database retrieval system