KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_00585Help
Entry
CLIBASIA_00585    CDS       T00948                                 

Definition
(GenBank) inorganic pyrophosphatase
  KO
K01507  inorganic pyrophosphatase [EC:3.6.1.1]
Organism
las  Candidatus Liberibacter asiaticus psy62
Pathway
las00190  Oxidative phosphorylation
Brite
KEGG Orthology (KO) [BR:las00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CLIBASIA_00585
Enzymes [BR:las01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.1  inorganic diphosphatase
     CLIBASIA_00585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyrophosphatase
Motif
Other DBs
NCBI-ProteinID: ACT56705
UniProt: C6XHG2
Position
complement(125155..125688)
Genome map
AA seq 177 aa AA seqDB search
MVQLNEISLGSNSPIDVNVFIEISLGGYPIKYEMDKKSGVLVVDRFISTPMLYPGNYGFI
PNTLSDDGDPVDVIMYSSEPILPGSVISTRPIGVMKMEDDGGIDEKILAVPSKNITSLYD
SIQSYEDVPNAYLQKVEHFFKHYKDLEDGKWAKLDGWEGVNSAHKIILEAVKRGIKE
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atggtacaattaaatgaaatttccttaggttctaattcgccaatagatgtgaatgttttc
atcgaaatttctcttggtggatatcctattaaatatgaaatggataaaaaaagtggcgtc
cttgtagtagatcgttttatttctacccctatgctttatccaggtaattatggttttatc
ccaaatacgctttctgatgatggtgatccagttgatgtaattatgtatagctcagaacct
attttaccgggttctgttataagtactcgccctataggggtgatgaaaatggaagatgat
ggaggaatagatgagaaaatacttgctgtcccatcaaaaaatataaccagcttatacgat
tccattcagagttatgaagatgttcccaatgcttacttgcaaaaggtggaacatttcttc
aagcattataaagatcttgaagatgggaaatgggctaaactagatggttgggaaggagtt
aacagtgctcataagatcatattagaggctgtaaaaagggggatcaaagagtaa

DBGET integrated database retrieval system