KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_00595Help
Entry
CLIBASIA_00595    CDS       T00948                                 

Gene name
argG
Definition
(GenBank) argininosuccinate synthase
  KO
K01940  argininosuccinate synthase [EC:6.3.4.5]
Organism
las  Candidatus Liberibacter asiaticus psy62
Pathway
las00220  Arginine biosynthesis
las00250  Alanine, aspartate and glutamate metabolism
las01100  Metabolic pathways
las01110  Biosynthesis of secondary metabolites
las01130  Biosynthesis of antibiotics
las01230  Biosynthesis of amino acids
Module
las_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:las00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CLIBASIA_00595 (argG)
   00220 Arginine biosynthesis
    CLIBASIA_00595 (argG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:las04147]
    CLIBASIA_00595 (argG)
Enzymes [BR:las01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.5  argininosuccinate synthase
     CLIBASIA_00595 (argG)
Exosome [BR:las04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CLIBASIA_00595 (argG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginosuc_synth
Motif
Other DBs
NCBI-ProteinID: ACT56707
UniProt: C6XHG4
Position
complement(127808..129022)
Genome map
AA seq 404 aa AA seqDB search
MSRDVKKVVLAYSGGLDTSIILKWLQVEKGLEVIVFIADLGQGEELKIASDKARLLGAKE
VYVKDLRREFVRDFVFPMFRANALYEGYYLLGTAIARPLIAKYLVDIANETGADAIAHGS
TGKGNDQVRFELSAYSLNSDIEIIAPWRHWSFKGRQDLIDFAEKHAIPIDKNKRGEAPFS
IDTNLLHSSSEGRVLEDPSQPAPEYVYKMIVSPEEAPDTPTTIRIDFQRGDPIAINGQVM
SPEVLLEQLNQYGRCNGIGRIDIVENRFVGIKSRGVYETPGGTILLHAHRAIESISLDSG
SAHLKDDLMSRYASIVYQGFWFSPEREMLQALIDKSQEYVEGSITLKLYKGNVMVVGRES
NKSLYSDKLVTFEDDLDAYNQSDSEGFIKLHALRLRTLARRNKV
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
ttgtctagagatgtaaaaaaagttgttttagcttattcaggcgggctcgatacttcgatt
atattgaaatggcttcaagtagaaaaaggcctagaagtaatagtatttattgctgatctt
ggtcaaggggaagaactgaagatagcatccgataaagctaggttacttggggcaaaagaa
gtttacgttaaagatttacgaagagaatttgtgcgtgattttgtgttccctatgttcaga
gccaatgctttgtatgaagggtattatttattaggtacagctattgctcgtcctctgatt
gctaaatatctagttgatatagcaaatgaaacaggagcagatgcaattgcgcatggatct
actggtaagggaaatgatcaagtacgtttcgaattatctgcttattctttgaattcggac
atagaaattattgctccatggagacattggtcgtttaaaggtaggcaggatctcattgat
tttgctgaaaaacatgcgattcctattgataaaaataaacgaggagaggcacccttttcg
atagatactaatttattacattcttcttctgagggtagagtattagaagatccatcgcag
ccagcaccagaatatgtctataaaatgattgtttctccggaagaagctccagacactcct
actactattagaattgattttcagcgaggtgatcctatcgctattaatggtcaggtaatg
tcaccagaggtattactagaacaattgaatcaatatggtcgttgtaatggaattgggcgc
attgatatagtggagaatagatttgtagggattaaatctcggggagtgtacgaaactcct
ggaggtacgattttgttacatgcgcatcgtgctattgaatctatttccttggattcagga
tctgctcatttaaaagatgatttgatgtcccgatatgcaagtatagtctatcagggtttt
tggttttctcctgaaagggagatgttgcaagcattgattgataagagtcaagagtatgta
gaaggttctattacgctaaaactgtacaaaggaaatgtgatggttgttgggcgtgaaagc
aataaatctttatattcggacaagcttgtcacttttgaagatgacttggatgcttataat
caaagtgattcggaaggttttataaaactgcatgctttacgtttgcgtactcttgcaagg
cgtaataaagtttag

DBGET integrated database retrieval system