KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_00645Help
Entry
CLIBASIA_00645    CDS       T00948                                 

Gene name
rpsE
Definition
(GenBank) 30S ribosomal protein S5
  KO
K02988  small subunit ribosomal protein S5
Organism
las  Candidatus Liberibacter asiaticus psy62
Pathway
las03010  Ribosome
Brite
KEGG Orthology (KO) [BR:las00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    CLIBASIA_00645 (rpsE)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:las03011]
    CLIBASIA_00645 (rpsE)
Ribosome [BR:las03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    CLIBASIA_00645 (rpsE)
  Bacteria
    CLIBASIA_00645 (rpsE)
  Archaea
    CLIBASIA_00645 (rpsE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S5_C Ribosomal_S5
Motif
Other DBs
NCBI-ProteinID: ACT56717
UniProt: C6XHH4
Position
complement(134556..135155)
Genome map
AA seq 199 aa AA seqDB search
MAQKERSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFA
HSTAREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAG
GAIRAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARR
VVSSKSSSYSRDSKNKGGN
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaaaaagagcgttctcagcgtgataattggcagaaccgtgaagagcgtgataat
agcattgttgatcggattgttgcgatcaatcgcgtttctacagctcttccaggtggtcgt
cgatttgcattttctgttttagttgttgtaggagatactaaaagtaaggttggttttgct
catagtactgctcgtgaggttccggaagctgttcggaaggcaactgaggcggcaaagcgt
aacatgatatctgtctcattattggatgggcgcactttgcatcacgatggtgtggggcgt
catggagctgggaaagttattatgagatctgctatggctggaactggtgttattgctggc
ggagctattcgtgcagtttgtgaagttcttggtatgcatgatgtagttgccaagtctatt
ggttcttctaatccgcacaatgtaatacgtgctacctttgaggtgcttcgttctcagtct
cacccgagagatgttgctaatcgtagaggtataaagcattctcttcttcaggcaaggcgt
gttgtttcttccaaatctagttcttattccagagattccaaaaataagggaggtaactag

DBGET integrated database retrieval system