KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_00710Help
Entry
CLIBASIA_00710    CDS       T00948                                 

Gene name
rpsS
Definition
(GenBank) SSU ribosomal protein S19P
  KO
K02965  small subunit ribosomal protein S19
Organism
las  Candidatus Liberibacter asiaticus psy62
Pathway
las03010  Ribosome
Brite
KEGG Orthology (KO) [BR:las00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    CLIBASIA_00710 (rpsS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:las03011]
    CLIBASIA_00710 (rpsS)
Ribosome [BR:las03011]
 Ribosomal proteins
  Bacteria
   Small subunit
    CLIBASIA_00710 (rpsS)
  Archaea
    CLIBASIA_00710 (rpsS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S19
Motif
Other DBs
NCBI-ProteinID: ACT56730
UniProt: C6XHI7
Position
complement(140286..140564)
Genome map
AA seq 92 aa AA seqDB search
MARSVRKGPFVTKSLLKKVSQARDSGGRGVVRVWCRNCDIMPQFIGLTFGVYNGRKHVPV
SVSEEMVGFKLGDFAPTRHCPGHGSDKKAKRK
NT seq 279 nt NT seq  +upstreamnt  +downstreamnt
gtggcgcgttcagttcggaagggtccttttgttaccaagtctcttcttaaaaaagtatcg
caagctcgtgattcaggtggtcgtggtgttgtgcgggtatggtgtcgtaattgtgatatt
atgccacaatttatcggtttgacatttggtgtatataatggtcgtaagcatgtgcctgta
tctgttagtgaggagatggttgggtttaagcttggtgattttgctccgacgcgtcattgt
ccagggcatggtagtgataaaaaggctaagaggaagtag

DBGET integrated database retrieval system