KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_00810Help
Entry
CLIBASIA_00810    CDS       T00948                                 

Definition
(GenBank) DNA polymerase I
  KO
K02335  DNA polymerase I [EC:2.7.7.7]
Organism
las  Candidatus Liberibacter asiaticus psy62
Pathway
las03030  DNA replication
las03410  Base excision repair
las03420  Nucleotide excision repair
las03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:las00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    CLIBASIA_00810
   03410 Base excision repair
    CLIBASIA_00810
   03420 Nucleotide excision repair
    CLIBASIA_00810
   03440 Homologous recombination
    CLIBASIA_00810
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:las03032]
    CLIBASIA_00810
   03400 DNA repair and recombination proteins [BR:las03400]
    CLIBASIA_00810
Enzymes [BR:las01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     CLIBASIA_00810
DNA replication proteins [BR:las03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    Other elongation factors
     CLIBASIA_00810
DNA repair and recombination proteins [BR:las03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA polymerase I
     CLIBASIA_00810
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     CLIBASIA_00810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol_A 5_3_exonuc_N 5_3_exonuc DNA_pol_A_exo1 HHH_2
Motif
Other DBs
NCBI-ProteinID: ACT56750
UniProt: C6XHK7
Position
161960..164890
Genome map
AA seq 976 aa AA seqDB search
MQKENHLFLVDGSSFIYRAFYATPLLSRKHDGLPVNAIAGFCNMLWKLLQNSRKESIASH
FAVIFDYPAVTFRNEIYPDYKANRPKIPEMLLPQLPLVRLATQAFGIPAIEIQGFEADDI
IATYTYIAEKEGFAVTIISTDKDLMQLVSPTTCLYDTVKEEKIDIEHVIKKWGIPPEKMV
CLQALTGDSIDNIPGIPGIGYKTAALLLQEYGNLENILINASRIKQKKRRENILEYAETA
RLSRKLVMLRTDVPITIPLEHLILEDCNGPRLISFLKALEFTKLINRVATTYDCDAANIE
PVVLDINTTENKGIAIETEIDRDTTIKTSQFSSLSDQTSKINSEQTPQKLFLERLQKLSQ
YPINNDSYTKIVNTKDIQQWVQKLETIGSASFKIITDTMDAFHSKPIAIAISTLDQKDDT
SFKVETIFIDLSVHTSQDSTGKNTLTKEILSYLKKFFENEHFLKIGHNIKYDKLVLHRYG
ISMRGFEDIMLMSYVLDSGRSSHDIASIAQKWLSYTRKEILKSRKSSIPIDKISDSQVQE
HAIENSNVILQLWLLLRPKLIVEKLLHVYERLDKPMIDVVSQMEITGIQIDQDLLKQVSA
EISKNLLSLEENIYDLSGEKFNLSSPKQLGDILFTKLKFPSGAKTKTGQWKTTAQDLEQI
NCGDNPIIKNILEWRQLSKIKSTYADSLPNHINKRTQRVHTFYSLASTMTGRLASLEPNL
QNIPIKTDLGQKIRRAFISPPTKKLISADYSQIELRILAHIAKITPLYQVFENSLDIHRM
VAAEIFGVNIEKVSPQMRRHAKTINFSIIYGISPFRLATQLRIPRSEAADYIKRYFHRFP
GIHEYIEKTKNFVRQNGYVETIFGRRIHYDEINSPKSSIRNINERAAINAPIQGSAADIT
RRAMISVHKSLEDHKLATKMLLQIHDELVFEVPEEEITTASQIIVHSMEKACLPKINLRV
PLKVNIKVSNNWQEEN
NT seq 2931 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaagagaatcatctttttctcgttgatggatctagtttcatatacagagccttt
tacgcaacccctttactttctcgtaaacacgatgggctacctgttaatgctattgctggt
ttctgcaatatgctatggaaattattgcagaattctcgcaaagaaagtatagcatcacac
tttgctgtcatctttgattatcctgctgtaacttttcgtaatgaaatttatcctgattat
aaagctaatcgccctaagattcccgaaatgttgcttccacaattgccgcttgtacgtctt
gcgacacaagcatttggaatacctgccattgaaatccaagggtttgaagcagatgatatt
attgcaacctatacatatattgctgaaaaagaaggatttgccgttaccattatctctaca
gataaagatttaatgcaactagtcagccctactacttgtctatacgatactgttaaagaa
gaaaaaatagacattgaacatgtcattaaaaagtggggcatccctccagaaaaaatggta
tgcttacaagcattaacgggagattcaattgataatatcccaggtatcccgggtataggc
tataaaaccgcagcattacttctacaagaatatggaaaccttgaaaatattcttatcaat
gccagtagaataaaacaaaaaaaaaggcgcgaaaacattttagaatacgctgaaacagct
cgtctttcccgcaaactcgtaatgctacgcaccgatgtacctatcactattccactagag
catcttatattagaagattgcaatggtccgcgtcttatttcctttcttaaagcacttgag
tttacaaaacttattaaccgtgttgctacgacttacgactgcgatgcagcgaacattgaa
cctgtcgttttagatataaatactactgaaaataaaggtattgcgatagaaacagaaata
gacagagatacaactataaaaacaagccaattcagtagcctttcagatcaaaccagtaaa
ataaattcagaacagacccctcaaaaattattcttagaacgtttgcaaaaactaagccaa
tatcccataaacaatgattcttataccaagatcgtcaatactaaagatatacaacaatgg
gttcaaaaactggaaacaattggcagcgcttcttttaaaatcatcacagatacaatggat
gctttccattccaagcccatcgctattgcaatcagcactctcgatcaaaaagatgataca
tctttcaaagtagaaactatcttcattgatctttcagtacatacctcgcaggattccaca
ggaaaaaatactttaaccaaagaaattctatcatacttaaaaaaatttttcgaaaatgaa
cactttctgaaaataggccataacatcaaatatgataaattagtgctccatcgttatgga
ataagcatgcgtggtttcgaagatattatgctcatgtcctatgttttggattctggacgc
tcttctcatgatatagcaagcattgctcaaaaatggctatcttatacacgtaaagagata
ttgaaatcaagaaaatcctctatacccattgacaaaatatctgattcgcaagtccaagaa
cacgctatagagaatagtaacgttatcttacaattatggttacttcttagaccaaaatta
attgtcgaaaaattgctccatgtatatgagcgattggataaaccaatgattgatgttgta
tcacaaatggaaataacaggcattcaaatagatcaggacctgcttaagcaggtctcagcc
gaaatatcgaaaaatctcttgtctctagaagaaaacatatatgatctttccggagaaaaa
ttcaatctcagctctcctaagcaattaggagatattttatttacaaaactaaaattccca
agtggagcaaaaacaaaaacaggacaatggaaaactacagctcaagaccttgaacagata
aactgtggtgacaatccgatcataaaaaatatcttggaatggcgtcaactttcaaagata
aaatccacatacgctgattctcttccaaaccacattaataaaaggacacagcgtgttcac
actttttattccttagcctccacaatgactggacgccttgcttccctagaacctaatctt
caaaatatccctataaaaactgatttaggacaaaaaattcgcagagcatttatttcccct
cctactaaaaaacttatttctgcagattacagccaaattgaattgcgcattctagcacat
atagcaaaaataactcctttatatcaagtatttgaaaattcattggatatccataggatg
gtagcagcagaaatttttggtgtaaacatagaaaaagtgtctccacagatgcggcgccat
gcaaaaactatcaattttagtatcatttatggcatttcaccttttagacttgccactcag
cttaggattccacgttctgaagctgccgattacattaaacgctatttccatcgttttcca
ggaatacatgaatatatcgaaaagacaaaaaattttgttcggcaaaatggatatgtagaa
actatctttggacgtcgtatacattatgatgaaataaattcccctaagtcctcaattcgc
aacatcaacgaacgagcagcgattaacgctccaattcaaggatctgccgccgatattaca
cgtagagccatgatttcagtacataaatctctcgaagatcataaacttgcaaccaaaatg
ttattgcaaattcacgacgagcttgtttttgaagttccagaagaagaaatcacgacagcc
tctcaaatcattgttcactcaatggaaaaagcatgtcttcctaaaataaatctgagagtc
ccattaaaagtgaatataaaagtctcgaataactggcaagaagaaaattaa

DBGET integrated database retrieval system