KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_00830Help
Entry
CLIBASIA_00830    CDS       T00948                                 

Definition
(GenBank) cytochrome-c oxidase assembly factor protein
  KO
K07152  protein SCO1/2
Organism
las  Candidatus Liberibacter asiaticus psy62
Brite
KEGG Orthology (KO) [BR:las00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:las03029]
    CLIBASIA_00830
Mitochondrial biogenesis [BR:las03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-IV assembly factors
    CLIBASIA_00830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SCO1-SenC AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: ACT56754
UniProt: C6XHL1
Position
complement(168162..168767)
Genome map
AA seq 201 aa AA seqDB search
MKALGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSI
VFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDR
IIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYK
DDSDSAIEKINRLITYGNVVK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
ttgaaggcgttagggataattttaggtactatactcctagcagtattagggagtattgct
tacgtatcattcagttcaaaatttgttgacggaaataggaggttcaatagcgatgttcat
ctagttgcgcaagacggcacagatttttcgcttagttctctatatatcaagccttctatt
gttttttttggattcacaaactgttctgcagtttgtcctactacgctttctagattagat
cgtttgttgaaacaggttgatccaactgggacattattgaacgcgtattttattacggtt
gatcccaaaagagatacccctgaggttatgaaaaagtttgtccagcgattctctgatcgt
attatagggatatcaggggatcctattgatgttatgcgtgtggcaaagaattttcgcatc
tatgtcaataatgttttagcagaaaaatcaggtgtagaagaaaaatattttgttgatcac
acaacagcccttttgttgtttgatactgctggaagcattgtgggtgttattccttataaa
gacgattcagattctgctattgaaaaaataaatcgattaattacctatggaaatgtagtc
aaataa

DBGET integrated database retrieval system