KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_00860Help
Entry
CLIBASIA_00860    CDS       T00948                                 

Definition
(GenBank) iron-sulfur cluster assembly accessory protein
Organism
las  Candidatus Liberibacter asiaticus psy62
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-S_biosyn
Motif
Other DBs
NCBI-ProteinID: ACT56760
UniProt: C6XHL7
Position
176457..176786
Genome map
AA seq 109 aa AA seqDB search
MVPIIKITDAAATQIKTILESNSDKKALRITIEGGGCSGFSYKFDLESKQSEDDIVFEKN
GAQIFIDKISLAYLTNSEIDFVDNLLSKSFQIRNPNATSNCGCGTSFSI
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atggtacccattataaagattaccgatgccgctgccacacaaattaaaactattttggaa
tccaacagtgacaaaaaggcgcttcgcattactatagaaggtggcggatgttctggattt
tcgtataaatttgatctagaatcaaagcaatctgaagacgacattgtatttgaaaaaaat
ggcgctcaaatattcatagataaaatatcacttgcatatctcaccaactcagaaatagat
tttgtagacaacttattaagcaaatctttccaaatacgtaaccctaatgctacaagtaac
tgcggttgtggaacaagtttttccatataa

DBGET integrated database retrieval system