KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_00885Help
Entry
CLIBASIA_00885    CDS       T00948                                 

Gene name
rplM
Definition
(GenBank) 50S ribosomal protein L13
  KO
K02871  large subunit ribosomal protein L13
Organism
las  Candidatus Liberibacter asiaticus psy62
Pathway
las03010  Ribosome
Module
las_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:las00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    CLIBASIA_00885 (rplM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:las03011]
    CLIBASIA_00885 (rplM)
Ribosome [BR:las03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    CLIBASIA_00885 (rplM)
  Bacteria
    CLIBASIA_00885 (rplM)
  Archaea
    CLIBASIA_00885 (rplM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L13
Motif
Other DBs
NCBI-ProteinID: ACT56765
UniProt: C6XHM2
Position
183368..183835
Genome map
AA seq 155 aa AA seqDB search
MIPTFFQKSSEVEKKWILVDAKGLIVGRLASQIALRLRGKNKPTYTPSADDGDHVVIINA
SKVAFSGKKYDQKTYYRHTGYPGGIKKTTAKEILAGASPTNILKKAIARMLPRGPLARKQ
MKNLHIYAEDHHPHEAQKPVFMDIAKMNPKNSRRT
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atgataccaaccttctttcaaaaatcgagtgaagtggaaaaaaaatggatattagttgac
gcaaaaggattaattgttggaagattggcgtctcaaatagccctccgtttacgcggaaaa
aacaagcctacctacacaccgagcgctgatgatggagatcatgttgtgattattaatgcg
tctaaagtagcgttttcgggaaagaaatatgaccaaaaaacctattatcgtcatactggc
tatccagggggtataaagaagacgactgcaaaagaaatacttgcaggggcttctccaact
aatattcttaagaaagcgattgcgagaatgcttccaagaggtcctcttgcgagaaaacaa
atgaagaatttacacatctatgccgaagaccatcatcctcatgaagcgcaaaagccggta
ttcatggatatcgcaaaaatgaatcccaaaaactctaggagaacttaa

DBGET integrated database retrieval system