KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_00985Help
Entry
CLIBASIA_00985    CDS       T00948                                 

Definition
(GenBank) response regulator receiver protein
  KO
K13589  two-component system, cell cycle response regulator CpdR
Organism
las  Candidatus Liberibacter asiaticus psy62
Pathway
las02020  Two-component system
Brite
KEGG Orthology (KO) [BR:las00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CLIBASIA_00985
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:las02022]
    CLIBASIA_00985
Two-component system [BR:las02022]
 Cell cycle family
  CckA-CtrA/CpdR (cell cycle control)
   CLIBASIA_00985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg
Motif
Other DBs
NCBI-ProteinID: ACT56785
UniProt: C6XHP2
Position
202550..202918
Genome map
AA seq 122 aa AA seqDB search
MNQKILLAEDDDDMRRFLIKALGKAGYEVVSCNNGASAYDKVREEPFSLLLTDIVMPEMD
GIELARRATELDPDLKVMFITGFAAVALNPDSNAPKNAKVLSKPFHLRDLVNEVNRLLTI
KN
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaaaaaattttgcttgctgaagatgatgatgatatgcgccgttttttgataaaa
gccttgggaaaggctggatacgaagtcgtatcctgcaataatggagctagtgcatatgat
aaagttcgcgaagaacctttttccctgcttttaacggatattgtcatgccagaaatggat
ggtattgaattggcacgtcgagcgactgaattagatcccgatttgaaagtaatgtttatt
acgggttttgctgccgttgctttgaatcctgattctaatgctcctaaaaatgcgaaagtc
ctctcaaaacccttccatctacgagatctcgttaatgaagtaaatagattgttgactata
aaaaattaa

DBGET integrated database retrieval system