KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_00995Help
Entry
CLIBASIA_00995    CDS       T00948                                 

Definition
(GenBank) outer membrane protein
Organism
las  Candidatus Liberibacter asiaticus psy62
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Porin_2
Motif
Other DBs
NCBI-ProteinID: ACT56787
UniProt: C6XHP4
Position
complement(205404..206459)
Genome map
AA seq 351 aa AA seqDB search
MGLKKFFLGTVAVATIISYSESFAYVRGKTSMVSNNRARNRSAGKVGNVLPHITKVGGSL
EKSLQARYHKLNGNNEFNSLAYDIPVKGNLEVNANAGDVTGVAKLKLAVDDVLSMQFAES
DVRALAFTVPSSKLSVEELSLSMKGARLGYYKSWSDEVNPVYSPTTLYNDARGLDKMMSL
SYRHSFGLLKAGLSTDLLQKDGLKQVLGIGYMASYAIGKIRSTVTGGYDAGTNNVAIRAN
ISSPVSRAGTLDCGAVWASGDNSYYDKSKYSVFAGYKFDVAKSITISGGGQYFGDINKTG
KDGWSAGISAKYMISSGLEAQASVAFNDNFVKKGVAIDKGVDLSVGLKKSF
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgggattaaaaaaattttttttaggcactgttgcggttgctacaattatctcttatagc
gagtcttttgcatatgttcgtgggaaaacgtcaatggtttctaataacagggctcgcaat
cggagcgctggcaaggtgggtaatgttcttcctcatattacgaaagttggtgggtctttg
gaaaaaagtttgcaggctcggtaccacaaactaaacgggaacaatgaatttaatagtctt
gcatatgatatacctgtaaaaggaaatcttgaagtcaatgctaatgcaggggatgttaca
ggtgtcgccaaattgaaattagctgttgatgatgtcttatcgatgcagtttgctgaatcg
gatgttagggctttggcatttactgtaccatctagtaagctttctgtagaagagttgtct
cttagcatgaaaggagcacggttgggttattataagtcttggagtgatgaagttaatcct
gtttactctccgactactctttataatgatgcccgaggtttagataagatgatgtctctt
tcttatcggcattcttttggtctactcaaagcaggtctttctacagatcttttgcaaaaa
gatggtctaaagcaagttttgggaataggatatatggcttcttatgctattggaaaaata
cgttctacagtgacaggtggctatgatgcaggtactaacaatgtagctatacgtgctaat
atttcttctcctgttagtcgcgctggtactcttgattgtggtgccgtgtgggctagtggt
gataattcgtactatgataagtctaaatattctgtttttgctggatataagtttgatgtt
gcgaaaagtataactatttctggagggggacagtattttggggatatcaataagactggt
aaagacggctggtcggctggtatttccgctaagtatatgatttcatcgggattagaagcg
caggcttctgtagcttttaatgacaattttgtgaagaaaggtgttgctatcgataaagga
gtggatctctcagttggtttaaagaaatctttctaa

DBGET integrated database retrieval system