KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_01000Help
Entry
CLIBASIA_01000    CDS       T00948                                 

Definition
(GenBank) hypothetical protein
Organism
las  Candidatus Liberibacter asiaticus psy62
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ACT56788
UniProt: C6XHP5
Position
complement(206780..206917)
Genome map
AA seq 45 aa AA seqDB search
MRSIWELSLGGSPCLMFFLLRSFLKDQIVFFKLKFLRFDLYFLGK
NT seq 138 nt NT seq  +upstreamnt  +downstreamnt
atgcgttcaatatgggagttgtctcttggtggttcgccatgtcttatgttctttttattg
cgttcatttttaaaagatcagatagttttttttaaattaaaatttttacgcttcgattta
tattttttgggcaaataa

DBGET integrated database retrieval system