KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_01065Help
Entry
CLIBASIA_01065    CDS       T00948                                 

Definition
(GenBank) UDP-glucose 4-epimerase
  KO
K01784  UDP-glucose 4-epimerase [EC:5.1.3.2]
Organism
las  Candidatus Liberibacter asiaticus psy62
Pathway
las00052  Galactose metabolism
las00520  Amino sugar and nucleotide sugar metabolism
las01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:las00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    CLIBASIA_01065
   00520 Amino sugar and nucleotide sugar metabolism
    CLIBASIA_01065
Enzymes [BR:las01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.2  UDP-glucose 4-epimerase
     CLIBASIA_01065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD RmlD_sub_bind Polysacc_synt_2 NAD_binding_4 NmrA adh_short KR NAD_binding_10
Motif
Other DBs
NCBI-ProteinID: ACT56801
UniProt: C6XHQ8
Position
223175..224176
Genome map
AA seq 333 aa AA seqDB search
MENKNVLVVGGAGYIGAHTCRVLYERGFLPIVLDNLSSGHAEFVLWGPLEQVDICDYTNL
RAVFAKYQPASVMHFAGLTNISESVKNPSLFYEINIKGSFNLIATAIESNVRRFIFSSTC
ATYGIPHNTIITENDPQESITPYGYTKYVVERELLQHNKVNGLRSVVLRYFNAAGATLDS
IIGEWHNPETHVIPLAIKTAMGYQNSFKVFGQDYATRDGTCLRDYIHVLDLANAHIMALE
YLINQGDSIAINLGTGTGITVKEIISTIQSMYECAFPITYESRRIGDPPSLVADNKKAKK
ILGWNPKYKLRDIIESAWNWHLKYPRSLSNEHE
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacaaaaatgttctcgttgttggaggagctggatacatcggtgcccatacttgt
cgcgtcctatacgaaagaggttttttacccattgtattggataatttatcaagtgggcac
gctgaatttgttttatggggaccgttagaacaagtagatatctgcgattatacaaatctt
cgcgcagtctttgccaagtaccaaccagcgtctgttatgcattttgcaggcttaactaac
atcagtgaatctgtaaaaaatccttctttattttatgaaattaatattaagggtagtttt
aatctcattgcaaccgctatagaatcaaatgtaagaagatttatcttttcttctacttgc
gcaacatacggcatacctcacaacacgatcatcacggaaaatgatccacaagaatcaata
acaccttatggatacacgaaatacgtagtagaaagagaactactacaacataataaagta
aatggattacgatctgttgtacttagatatttcaatgcagctggcgcaacattggatagc
atcattggagaatggcataatcctgaaactcatgttattccattagcaattaaaacagcc
atgggttatcaaaatagtttcaaagtttttgggcaagattatgcaacaagggatgggact
tgtttgcgtgattacattcatgtcctcgatttagctaacgcccatataatggcattagaa
tacttgataaatcaaggtgatagtatagctatcaatcttggaactgggacaggaatcacg
gtcaaagaaattatctctactatccaatcaatgtatgaatgtgccttccctatcacttac
gaatccagacgcataggagaccccccttcccttgtagccgataataaaaaagcaaagaaa
attttggggtggaatccaaaatataaattacgtgatattatagaatctgcttggaattgg
catctcaaatatcctagatctctatcaaatgaacatgagtaa

DBGET integrated database retrieval system