KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_01070Help
Entry
CLIBASIA_01070    CDS       T00948                                 

Gene name
rpsF
Definition
(GenBank) 30S ribosomal protein S6
  KO
K02990  small subunit ribosomal protein S6
Organism
las  Candidatus Liberibacter asiaticus psy62
Pathway
las03010  Ribosome
Brite
KEGG Orthology (KO) [BR:las00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    CLIBASIA_01070 (rpsF)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:las03011]
    CLIBASIA_01070 (rpsF)
   03029 Mitochondrial biogenesis [BR:las03029]
    CLIBASIA_01070 (rpsF)
Ribosome [BR:las03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    CLIBASIA_01070 (rpsF)
  Bacteria
    CLIBASIA_01070 (rpsF)
Mitochondrial biogenesis [BR:las03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    CLIBASIA_01070 (rpsF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S6 DUF3827 BRCT_2
Motif
Other DBs
NCBI-ProteinID: ACT56802
UniProt: C6XHQ9
Position
224635..225042
Genome map
AA seq 135 aa AA seqDB search
MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY
VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR
NVDRKQHVSEEKPLS
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atgaaactatacgagcatgttttcctcttgcgacaggatatctcgagtcaacagattaag
gatacaattgggcagtatcaatctttgattcaggaaaatggtggcgaggttcgtcttgta
aacgaattgggaatgcgaaccattgcgtatcgaatccgtaaaaatcgcaaagcctactac
gttttcatgaatattgcatctcctcctgctgctattcatgaaatgaagcgaaagatgcgt
attgatgagaatgttttacgctctcttacgcttttagttgattctcacgaacagtcacca
actctaacaatacaaagacatgatcgcgacgatagaaacgaccggttccctagagatcga
aacgtggatcgtaagcaacatgttagcgaagaaaaacctttatcatag

DBGET integrated database retrieval system