KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_01160Help
Entry
CLIBASIA_01160    CDS       T00948                                 

Gene name
ribE
Definition
(GenBank) riboflavin synthase subunit alpha
  KO
K00793  riboflavin synthase [EC:2.5.1.9]
Organism
las  Candidatus Liberibacter asiaticus psy62
Pathway
las00740  Riboflavin metabolism
las01100  Metabolic pathways
las01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:las00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    CLIBASIA_01160 (ribE)
Enzymes [BR:las01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.9  riboflavin synthase
     CLIBASIA_01160 (ribE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lum_binding
Motif
Other DBs
NCBI-ProteinID: ACT56820
UniProt: C6XHS7
Position
complement(242218..242832)
Genome map
AA seq 204 aa AA seqDB search
MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD
NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG
DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG
DLINIEVDSMMRYIARLYALNTSQ
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
gtgtttacaggaattgtgacggatataggcaaaattatagctatgacaccaatagcaaaa
ggtatgcgattgcgtgtaatgacatcttacaacacttctaaaatgaaactcggttgctct
atagcacacgctggtatttgtttaacggttgtacgactatcagaagagcattcggttgat
aattggtatgaagtagaagtttgggcggagactaatcggatcactaatatagcttcatgg
ggtatagggacttttattaatttagaaagatccgtgaaattaggtgatcgattggacgga
caccttgtttctggtcatattgatgggacggtagaaattctttttctagattttattggc
gactctatgtattgtcgtctcagtcttcctcataacttagaacaatttatagcagttaag
ggatccgtatgccttaatggagtgtcattaacagtgaatttagtaggtaagaattttttt
gatgttttattaattcgtcatactattgaggagacaacgtggaagatgcataaagtaggt
gatttgatcaatatagaagtagattctatgatgcgttatattgcacgattatatgcgttg
aatacttctcagtag

DBGET integrated database retrieval system