KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_01165Help
Entry
CLIBASIA_01165    CDS       T00948                                 

Definition
(GenBank) 5-amino-6-(5-phosphoribosylamino)uracil reductase/diaminohydroxyphosphoribosylaminopyrimidine
  KO
K11752  diaminohydroxyphosphoribosylaminopyrimidine deaminase / 5-amino-6-(5-phosphoribosylamino)uracil reductase [EC:3.5.4.26 1.1.1.193]
Organism
las  Candidatus Liberibacter asiaticus psy62
Pathway
las00740  Riboflavin metabolism
las01100  Metabolic pathways
las01110  Biosynthesis of secondary metabolites
las02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:las00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    CLIBASIA_01165
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    CLIBASIA_01165
Enzymes [BR:las01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.193  5-amino-6-(5-phosphoribosylamino)uracil reductase
     CLIBASIA_01165
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.26  diaminohydroxyphosphoribosylaminopyrimidine deaminase
     CLIBASIA_01165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RibD_C dCMP_cyt_deam_1 MafB19-deam Inv-AAD
Motif
Other DBs
NCBI-ProteinID: ACT56821
UniProt: C6XHS8
Position
complement(242814..243908)
Genome map
AA seq 364 aa AA seqDB search
MPVSSFDARFMSAALRFSRWHVGLTSTNPSVACLIVKDGIVIGRGVTAYGGCPHAEVQAL
EEAGEEARGATAYVTLEPCSHYGRSPPCAQFIIECGIRRVVVCVDDPDVRVSGRGLQWLS
QKGIIVDRMMESEGKIFLHAYLTRQVEKRSHITLKIAVSQDNMIGMAGCGSVPITGFISK
NQVHLLRAQSDAILVGIGTVLADDPELTCRLNGLQEHSPMRIILDPHFKLSLDSKIIKTA
LLAPVIIVTENDDPVLALAFRKKNINIIYCDCRDLKKLLTILVGRGVTSLLVEGGAAVAH
SFINSRLVDSIILYRSQIVIGEGGIPSPLEEGYLEKNFMCVRRDYFGSDVCLEYIGKNLC
LQEL
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
gtgcctgtatcttcttttgatgcgaggtttatgtctgctgcgttgagattttctcgttgg
catgtgggtttaacttcgactaatccttctgttgcttgtttaattgttaaggatggaatt
gtcattggcagaggtgtgactgcttatggaggatgtccccatgctgaagtacaagctctt
gaagaagctggagaagaagcacgaggtgctacagcttatgttactttagaaccttgttcg
cattacggacgatctcccccttgtgcacaatttattattgaatgtggaataagacgtgtg
gttgtctgtgttgatgatcctgatgtgcgagtctctgggagagggctacaatggctatcg
caaaaaggcattattgttgacaggatgatggaaagtgaaggaaaaatatttcttcatgct
tatttgacacgtcaagttgaaaaacgatctcatattacacttaagattgcagtttctcaa
gataacatgattggtatggcaggatgcggatccgtacctattacggggtttatttcaaaa
aatcaagtgcatttattgagagcacagtcagatgctattcttgtaggtataggtacggta
cttgccgatgatccagaattaacttgtagattaaatggtttgcaggaacattctcctatg
cgtatcattctagatccacatttcaaactatctcttgattctaaaattataaaaacagca
ttattagcacctgttattattgtaactgagaatgatgatcctgttcttgctcttgccttt
agaaaaaagaatataaatattatttattgtgattgtcgtgatttgaaaaagttgttgacc
atattggtaggtcgaggtgttacttcgttattagtggaaggaggggcagcggtagctcat
tcttttatcaattctagattagtggattctattattctttatagatcacagatagtcata
ggtgaggggggtattccttctcctctagaagaaggatatcttgaaaagaattttatgtgt
gtccgacgtgattattttggttctgatgtttgtcttgagtatataggaaaaaatttgtgt
ttacaggaattgtga

DBGET integrated database retrieval system