KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_01230Help
Entry
CLIBASIA_01230    CDS       T00948                                 

Definition
(GenBank) ribosomal protein L32
  KO
K02911  large subunit ribosomal protein L32
Organism
las  Candidatus Liberibacter asiaticus psy62
Pathway
las03010  Ribosome
Brite
KEGG Orthology (KO) [BR:las00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    CLIBASIA_01230
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:las03011]
    CLIBASIA_01230
   03029 Mitochondrial biogenesis [BR:las03029]
    CLIBASIA_01230
Ribosome [BR:las03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    CLIBASIA_01230
  Bacteria
    CLIBASIA_01230
Mitochondrial biogenesis [BR:las03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    CLIBASIA_01230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L32p
Motif
Other DBs
NCBI-ProteinID: ACT56834
UniProt: C6XHU1
Position
complement(258969..259154)
Genome map
AA seq 61 aa AA seqDB search
MAVPKRKTSPSKRGMRRSADALTPPAYVEDKKSGELRRPHHVDMKTGLYRGRQVFVLKTK
E
NT seq 186 nt NT seq  +upstreamnt  +downstreamnt
atggctgtccctaagagaaaaactagtccttcaaagcgaggtatgcgtcgttctgcggat
gccctgactccccctgcttatgtagaggataaaaagtctggagaattgcggcgtccacac
catgtagatatgaaaacaggtttgtatcgggggcgtcaggttttcgttttgaagacaaaa
gaataa

DBGET integrated database retrieval system