KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_01250Help
Entry
CLIBASIA_01250    CDS       T00948                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase protein
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
las  Candidatus Liberibacter asiaticus psy62
Pathway
las00040  Pentose and glucuronate interconversions
las00052  Galactose metabolism
las00500  Starch and sucrose metabolism
las00520  Amino sugar and nucleotide sugar metabolism
las01100  Metabolic pathways
las01130  Biosynthesis of antibiotics
Module
las_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:las00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CLIBASIA_01250
   00052 Galactose metabolism
    CLIBASIA_01250
   00500 Starch and sucrose metabolism
    CLIBASIA_01250
   00520 Amino sugar and nucleotide sugar metabolism
    CLIBASIA_01250
Enzymes [BR:las01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     CLIBASIA_01250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase CTP_transf_3 NTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ACT56838
UniProt: C6XHU5
Position
complement(262679..263578)
Genome map
AA seq 299 aa AA seqDB search
MGSLKKVRKAVFPIAGLGMRFFPISKVIPKEMLAIVDRPVIQYVIEEALEAGLTDFVFVT
GRGKGLIKDYFDIQFELEQSLRKRNKKAELTLLAESIPSIGNAVFTWQYERKGLGHAVWC
ARNIIGDNPFALLLPDMIMSPLEGENCMANMIKLYEKEGANILAVSECDPQLSCKYGMVQ
VGKAIDHQVFHISDMIEKPDSSTFISNFFINGRYILHPDIFSILNDWKENEGKGEIQLTD
SMRKLSERHDFLAYHFKGHTYDCGSKKGFVLANIAFALARQDIRSDIETDLKTLVSALK
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgggttcattgaaaaaggttcgaaaggcggttttccctattgcgggtttggggatgcgt
ttttttcctatttctaaggtgattcctaaagaaatgttagcgatagtcgatagacctgtt
atccaatatgttatagaggaagccttggaagctggattaacagattttgtgtttgttacg
gggcgtgggaaaggtttgatcaaggattattttgatattcaatttgaactggaacaatcc
ctcagaaaacgcaataaaaaagcggaattaaccttgctcgcagaatctattccttcgatt
gggaatgctgtatttacgtggcaatatgagaggaagggattggggcatgcggtatggtgt
gcgcgaaatattattggagataatccctttgctttgttgcttcctgatatgattatgtct
cctttagaaggagaaaattgtatggccaatatgatcaaattatatgaaaaagaaggtgca
aacattttagctgtttcagaatgcgatcctcaattatcttgtaagtatgggatggttcag
gtgggtaaagcaatcgatcatcaagtttttcatatatccgatatgattgagaagccagat
tctagcacgtttatttcaaatttttttattaatggtcgttatattttacatcccgatatt
ttcagcattttgaatgattggaaggaaaacgaaggtaagggtgaaattcagcttacggat
tctatgcgcaagttatctgaaagacacgatttcttggcatatcatttcaaagggcataca
tatgattgtggctcgaaaaaaggattcgttttggcaaatatcgctttcgctcttgcaaga
caagatattcgttctgatatagaaactgatttgaaaacgcttgtatctgcattaaaataa

DBGET integrated database retrieval system