KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_01265Help
Entry
CLIBASIA_01265    CDS       T00948                                 

Gene name
etfB
Definition
(GenBank) electron transfer flavoprotein beta subunit
  KO
K03521  electron transfer flavoprotein beta subunit
Organism
las  Candidatus Liberibacter asiaticus psy62
Brite
KEGG Orthology (KO) [BR:las00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99982 Energy metabolism
    CLIBASIA_01265 (etfB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ETF Ribosomal_L18
Motif
Other DBs
NCBI-ProteinID: ACT56841
UniProt: C6XHU8
Position
266258..267007
Genome map
AA seq 249 aa AA seqDB search
MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV
VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT
DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL
NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE
ILKSKHDLL
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgaagatactcgtacctattaaaggggtcataaattacaatacgaaggtacgtataaaa
aatgattactctggtattgagacagaaaatacgaagatatcaatgaacccttttgatgag
atcgcacttgaagaatccctacagttaagagaaaaaggaatagcaactgaagttatagta
gtgtccataggatcctgcaaagttgaagaagttctcaaaaattctttggctatgggagca
gatagaggtatccttattgaaagcaatgaaacgcttgaaccattgtcgatagcaaaaatt
cttcgtgagatagtaaaaaaggaaaatcccataatagtcattgctggcaaacaaactact
gacaatgaatcaaatcaaaccggacaaatgttggcagcattaatgcgatggcctcaagcg
acattcgtttccaatataaagattattgacaaccacgcaatcgtcacccgtgaagtaggt
catggcactatgactatggaaacccccttaccggcagtgatcacagtagatcttaatctc
aacgaacctcgttatatctctttgccaaatatcattaaggcacgtaaaaaacgtattgaa
aagaaaaaagccactgattttgcaatcgacttgacacctcgtctaaaagttctcagattc
gaagaaaatcgagcagaaagaaagggcttaaggctatattctactacaaaactcattgaa
atattgaagagtaaacatgacttattgtga

DBGET integrated database retrieval system