KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_01340Help
Entry
CLIBASIA_01340    CDS       T00948                                 

Definition
(GenBank) endonuclease III
  KO
K10773  endonuclease III [EC:4.2.99.18]
Organism
las  Candidatus Liberibacter asiaticus psy62
Pathway
las03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:las00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    CLIBASIA_01340
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:las03400]
    CLIBASIA_01340
Enzymes [BR:las01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     CLIBASIA_01340
DNA repair and recombination proteins [BR:las03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     CLIBASIA_01340
 Prokaryotic type
     CLIBASIA_01340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HhH-GPD HHH EndIII_4Fe-2S
Motif
Other DBs
NCBI-ProteinID: ACT56856
UniProt: C6XHW3
Position
279613..280296
Genome map
AA seq 227 aa AA seqDB search
MVSSKKSDSYQGNSPLGCLYTPKELEEIFYLFSLKWPSPKGELYYVNHFTLIVAVLLSAQ
STDVNVNKATKHLFEIADTPQKMLAIGEKKLQNYIRTIGIYRKKSENIISLSHILINEFD
NKIPQTLEGLTRLPGIGRKGANVILSMAFGIPTIGVDTHIFRISNRIGLAPGKTPNKVEQ
SLLRIIPPKHQYNAHYWLVLHGRYVCKARKPQCQSCIISNLCKRIKQ
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atggtttcatcaaaaaaaagcgatagctatcaaggaaatagccccttagggtgtttatat
actcccaaagaattagaagagattttttatcttttttctctaaaatggccctcgcccaaa
ggagaattatattacgtcaatcattttacgctgattgtggcagttctgctatcagcacaa
tccacagatgtcaatgtaaataaagcgacaaagcacctatttgagatagctgatacccct
caaaaaatgctcgcgataggagaaaaaaaactccaaaattatataagaactattggtatc
tatcgaaaaaaatcagaaaatattatctctttatcccatatactcatcaatgaatttgat
aataaaatacctcaaacattagaagggctaacacgattacccggaataggacgaaaaggc
gctaatgttattttatccatggcttttggaataccgaccatcggcgtagatacccatata
tttcgcatttccaatagaattggactagcacctggaaaaacccccaataaggttgaacaa
tctctgttgcgtattattccccctaaacatcaatataatgcacactattggcttgtttta
cacgggcgatacgtctgcaaggctcggaaaccacaatgccaatcatgtataatttccaac
ctttgcaaacgaataaaacaataa

DBGET integrated database retrieval system