KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_01395Help
Entry
CLIBASIA_01395    CDS       T00948                                 

Definition
(GenBank) putative permease protein
  KO
K11720  lipopolysaccharide export system permease protein
Organism
las  Candidatus Liberibacter asiaticus psy62
Pathway
las02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:las00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    CLIBASIA_01395
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:las02000]
    CLIBASIA_01395
Transporters [BR:las02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   Lipopolysaccharide transporter
    CLIBASIA_01395
 Other transporters
  Pores ion channels [TC:1]
   CLIBASIA_01395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LptF_LptG Rot1 DUF3377
Motif
Other DBs
NCBI-ProteinID: ACT56867
UniProt: C6XHX4
Position
293686..294771
Genome map
AA seq 361 aa AA seqDB search
MPGILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVP
LIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVI
NPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFT
SITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKF
SEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSR
SNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKED
G
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgccaggcatcttatggcgatactttttcaaatactatttgaaaactactttgtacttc
ttattaggagctatgatattggttttcgttattgacttgaatgaaatacagaatcaaatg
ggcgaattacccaattatagcatatctcgtggagcggtactagcagctacgcgcgtacca
ttaatcattcaacaaatcattccatttatcacactagttgtgaacatagttgtttttttt
aacctaaacagaaccagtgaattagtgatctcacgtgccataggaatttccatatggcaa
ctactcaatccttttgtcgttggatctattctattagggatttttacagtattagtgatc
aatccgattgctacatcaggagaaaaaataggcatcgatctcatacaacaatggaaagat
aatggcgacaaacaaaaatcagatatcatcccttggatgcaaataagcaatcctcagcaa
gatatcttcataggtgcaaaaaaaatactaccagaaaatcatatctgggaagatttcact
tctattactattgataaaaaaaacaaaattattcatcgaaaagatgccgatcttgctatc
atatacaatgacaaagtaaaactcaaaaaagtagttgagtatcaatatggcaggattcca
attgataaaaattcaacgacactcaatatccctattaaaatggatggttttcaaaaattt
tctgaacaattcgcatcgcgttccttttatgaaataatcaaaaagatgagtttctctaat
aaatcaaacatttttcataactatcgtgcggaaactcaattctattttctcatagttata
ccactcatgcttgtagctatgaccttgatagcggcctctgtgtctttagaatttagtcga
tctaatcagcctcgtattatcgtggcatacggaatattttctggatttatgctttatact
attataacaatcatgaaatcctttgggaaaagtggcattttgcttcctgttgccgccgcg
ttaattccagtgattctcacaatatcccttagcatattaattcttctgcagaaagaggac
ggttaa

DBGET integrated database retrieval system