KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_01415Help
Entry
CLIBASIA_01415    CDS       T00948                                 

Gene name
ksgA
Definition
(GenBank) dimethyladenosine transferase
  KO
K02528  16S rRNA (adenine1518-N6/adenine1519-N6)-dimethyltransferase [EC:2.1.1.182]
Organism
las  Candidatus Liberibacter asiaticus psy62
Brite
KEGG Orthology (KO) [BR:las00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:las03009]
    CLIBASIA_01415 (ksgA)
Enzymes [BR:las01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.182  16S rRNA (adenine1518-N6/adenine1519-N6)-dimethyltransferase
     CLIBASIA_01415 (ksgA)
Ribosome biogenesis [BR:las03009]
 Prokaryotic type
  rRNA modification factors
   16S rRNA modification factors
    CLIBASIA_01415 (ksgA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RrnaAD Methyltransf_25 Methyltransf_32 FtsJ GntR
Motif
Other DBs
NCBI-ProteinID: ACT56871
UniProt: C6XHX8
Position
299106..299960
Genome map
AA seq 284 aa AA seqDB search
MTMNNKSHSLKTILSHYKIIPKKYMGQNFLLDLNILKKIAESSGSLDGITVIEIGAGPGN
LTQMLLTLGARKVIVIEKDQQFFPILKDISSQHPNRLEIIQDDALKVDFEKFFNISSPIR
IIANLPYNIGTRLLFNWISADTWPPFWESLTLLFQKEVGERITAQKNSPHYGRLSVLTGW
RTKATMMFDISPHVFFPSPKVTSTVIHFIPHLNPIPCCLESLKKITQEAFGKRRKTLRQS
LKRLGGENLLHQAGIETNLRAENLSIEDFCRITNILTDNQDIAI
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgaccatgaacaataaatcacattccttgaaaactattctttctcattataaaattatt
cctaagaaatatatgggacaaaattttcttttggaccttaatattctgaaaaaaatcgcg
gaatcatcaggttcgttagatggaattaccgttatagaaattggtgcaggcccaggaaat
ttaacccaaatgctcctcacattaggggcgcgaaaagttattgttatagaaaaagatcaa
cagtttttcccaattctaaaagatatctcttcacaacacccaaatcgattagaaatcata
caagacgatgcgttaaaagtggattttgaaaaattcttcaatatatcctctccaattcgt
ataattgcaaatctcccatacaatattggaacacgattattatttaactggatttctgct
gatacctggcctcctttttgggagtcattaactctacttttccaaaaagaagtaggggaa
cgcataacagcacaaaaaaacagtcctcattatggaagattaagtgtccttactggttgg
agaacaaaagccacgatgatgtttgatatttcacctcatgttttttttccttcacctaag
gtaacttcaaccgttattcacttcattcctcatttaaatcctattccttgttgcttagaa
tctctcaaaaaaattacgcaagaagcctttgggaaaagacgcaaaacactaaggcaaagt
ttgaaaaggctcggtggtgaaaatttattgcaccaagcaggaatagaaacaaatctcaga
gccgaaaatctttctatagaagatttttgccgtatcacaaatatactgaccgataatcag
gatattgcaatttaa

DBGET integrated database retrieval system