KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_01440Help
Entry
CLIBASIA_01440    CDS       T00948                                 

Definition
(GenBank) hypothetical protein
Organism
las  Candidatus Liberibacter asiaticus psy62
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4170
Motif
Other DBs
NCBI-ProteinID: ACT56876
UniProt: C6XHY3
Position
complement(304618..304860)
Genome map
AA seq 80 aa AA seqDB search
MINGIQEEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNA
LMRYFVVDISRFPHYELGKE
NT seq 243 nt NT seq  +upstreamnt  +downstreamnt
gtgattaacggtatccaagaagaacaggttttgtatttggtatttggaggagaattagag
aatatcacgcagaaaaaaatgcgtaatcctgatgatatagatgtcgttggaatattttcc
agttattctaatgcgtatgatgtttggaaagaaaaatctcagcaaatggttgataatgca
ttaatgcgctacttcgtcgtagatatttctagattccctcattatgaattaggaaaagaa
tag

DBGET integrated database retrieval system