KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_01470Help
Entry
CLIBASIA_01470    CDS       T00948                                 

Definition
(GenBank) ribose-phosphate pyrophosphokinase
  KO
K00948  ribose-phosphate pyrophosphokinase [EC:2.7.6.1]
Organism
las  Candidatus Liberibacter asiaticus psy62
Pathway
las00030  Pentose phosphate pathway
las00230  Purine metabolism
las01100  Metabolic pathways
las01110  Biosynthesis of secondary metabolites
las01120  Microbial metabolism in diverse environments
las01130  Biosynthesis of antibiotics
las01200  Carbon metabolism
las01230  Biosynthesis of amino acids
Module
las_M00005  PRPP biosynthesis, ribose 5P => PRPP
Brite
KEGG Orthology (KO) [BR:las00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CLIBASIA_01470
  09104 Nucleotide metabolism
   00230 Purine metabolism
    CLIBASIA_01470
Enzymes [BR:las01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.1  ribose-phosphate diphosphokinase
     CLIBASIA_01470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pribosyltran_N Pribosyl_synth Pribosyltran UPRTase
Motif
Other DBs
NCBI-ProteinID: ACT56882
UniProt: C6XHY9
Position
complement(310019..310951)
Genome map
AA seq 310 aa AA seqDB search
MKIFAGNSNRNLAQEICDYLHTSLGKASVTYFSDREVFVEIGENVRGEDVFIVQSTSCPA
NDYLMELLIMIDAVRRSSARRITGVIPYFGYCRQDRKPSPRTPISAKLVANLITQAGADR
VIMLDLHAGQVQGFFDIPTDNLYALPILERDIKERNDISNLMVVSPDVGGVVRARALAKR
LGCLLAIVDKRREHPGKIEVMNIIGKVEGKDCILIDDIVDTGGTLCGAADALYEQGALSV
TAYITHGVLSSSSIERIEKSKMKELVITDSIQPTDLVKSSAKIRILTIAQLMGEAINRTF
EERSISSLFD
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatttttgcaggaaattccaataggaatcttgctcaagagatttgtgattatttg
catacctctttaggaaaggcttcggtcacatatttttctgatagagaagtatttgtggag
attggggagaatgtgcggggagaagatgtttttatagttcaatctacttcttgtcccgct
aatgattatttaatggaattgcttattatgatagatgctgtgcgtcgttcttctgcaagg
cgtattacaggagtaattccttactttgggtattgtcgtcaagatcgaaaacctagtcct
cgcacgcctatatctgctaaattagttgctaatttgattacgcaagctggagctgatcgt
gttatcatgttggatttacatgcaggacaagttcaaggtttttttgatattccgaccgat
aatttatatgcgttgcctattttagaacgtgacattaaagagcgtaatgatatttccaat
cttatggttgtttctcctgatgttgggggggtcgtgcgtgcacgtgcacttgctaaaagg
ttaggatgtttgttagccatcgttgataaaagacgagaacatccagggaaaattgaagtt
atgaatattatagggaaagtagagggtaaagattgtattcttattgatgatatcgtcgac
actggaggaacgctttgtggtgctgctgatgccctatatgaacagggagctttaagtgtg
acagcttacattacacatggtgttttatcgagctcttctattgagcgcatagaaaaatct
aaaatgaaagaattagtgattactgattctatacaacctacagatttagtaaaatcttct
gctaagatacgtattcttactattgctcagttaatgggagaagctattaaccgcactttc
gaagaacgatctatttctagtttatttgattaa

DBGET integrated database retrieval system