KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_01505Help
Entry
CLIBASIA_01505    CDS       T00948                                 

Definition
(GenBank) putative ferredoxin protein
  KO
K05524  ferredoxin
Organism
las  Candidatus Liberibacter asiaticus psy62
Brite
KEGG Orthology (KO) [BR:las00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99982 Energy metabolism
    CLIBASIA_01505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3470 Fer4 Fer4_16 Fer4_7 Fer4_10 Fer4_9 Fer4_6 Fer4_2 Fer4_8 Fer4_21 Fer4_4 Fer4_17
Motif
Other DBs
NCBI-ProteinID: ACT56889
UniProt: C6XHZ6
Position
320681..321022
Genome map
AA seq 113 aa AA seqDB search
MTYVVTENCILCKHTDCVEVCPVDCFYEGENFLAIHPDECIDCGVCEPECPVDAIKPDTE
PGLELWLKINSEYATQWPNITTKKESLPSAAKMDGVKQKYEKYFSPNPGGKNT
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgacatacgtcgtcactgaaaattgcatcttgtgtaagcatacagattgcgtggaagtt
tgtcctgtcgattgtttttacgaaggagaaaacttcttagcaatccatccagatgagtgc
atagattgtggggtatgcgagcccgaatgccccgttgacgccatcaaacctgataccgaa
ccaggattggaattgtggttaaaaataaattcagagtatgctactcagtggcctaatatt
acaacaaaaaaggaaagtctcccgagtgctgcgaaaatggatggtgttaaacaaaaatat
gaaaagtatttctcccctaatcctgggggaaaaaatacataa

DBGET integrated database retrieval system