KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_01585Help
Entry
CLIBASIA_01585    CDS       T00948                                 

Gene name
argD
Definition
(GenBank) acetylornithine transaminase protein
  KO
K00821  acetylornithine/N-succinyldiaminopimelate aminotransferase [EC:2.6.1.11 2.6.1.17]
Organism
las  Candidatus Liberibacter asiaticus psy62
Pathway
las00220  Arginine biosynthesis
las00300  Lysine biosynthesis
las01100  Metabolic pathways
las01110  Biosynthesis of secondary metabolites
las01120  Microbial metabolism in diverse environments
las01130  Biosynthesis of antibiotics
las01210  2-Oxocarboxylic acid metabolism
las01230  Biosynthesis of amino acids
Module
las_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:las00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    CLIBASIA_01585 (argD)
   00220 Arginine biosynthesis
    CLIBASIA_01585 (argD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:las01007]
    CLIBASIA_01585 (argD)
Enzymes [BR:las01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.11  acetylornithine transaminase
     CLIBASIA_01585 (argD)
    2.6.1.17  succinyldiaminopimelate transaminase
     CLIBASIA_01585 (argD)
Amino acid related enzymes [BR:las01007]
 Aminotransferase (transaminase)
  Class III
   CLIBASIA_01585 (argD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 Aminotran_5
Motif
Other DBs
NCBI-ProteinID: ACT56905
UniProt: C6XEV3
Position
338777..339955
Genome map
AA seq 392 aa AA seqDB search
MNKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQ
SEKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTN
KFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAI
LIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDI
MTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLEN
VINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSD
NVVRILPPLTITAEEIHEGLERIERTAIKLSH
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaaatgattttttatttaacacgtatgatcaatcagatattcgttttgaaaaa
ggaaaaggtgcatggctcttttccgaaaatggaatcccttttctggattttgcatctggt
attgcagttaattcccttgggcattcacatccagaattagttgcaatactcaaatcacaa
tctgaaaaactctggcatgtttcgaatctttatcagtcaacgcaacaagagatttttgca
aatcatctaatacacagtacttttgccgatagagttttttttactaattcaggagctgaa
tcagtggaatgtgccatcaaaacagcacgtcgctatcactatatggcaggtaaaactaat
aaatttcgcattgtgacatttgagggagcttttcatgggcgtaccctagcaacaatttcc
gcaggggggaaattacaatatttagaaggatttggccccaaaatagaagggtttgatcag
gctaaattttgtgatctccaatctcttaaaaatcaaattagcaatgacactgccgccatt
ttaatagaacctatccaaggtgagggtggcgttcgaaaagtgccagaagaatttttacaa
caactgcgtaaaatttgcgatgatattgatgctttactcatatttgacgaggttcaaaca
ggatatggacgtactggcaaattgtttgcttatgaatgggcaaatgttaaacctgatatt
atgacgattgctaaagggatgggaggcggatttcccataggagcgtgtttagcaacaaat
gaagtagctgcttgtatgaatcaaggatctcatggatccacatatggaggcaatgtcttg
gcaatggtattaggagaaaaagttctcaatatcatccaatccgatgggtttcttgaaaat
gtaattaacattgctaaaatactatttgaaggcttgactgcaatcaaaaatcgctttcca
aacatgttcttagaggtgcggggacaggggttattgataggattaaaaactgtattttct
cctgcattactagcagcaaaattcagagatgaatgtcttttaaccgccccatctagcgat
aatgtggtacgcattctccctcctcttacaatcactgcagaggaaattcatgaaggatta
gaacgcatagaacgcactgcaatcaagctatcacactaa

DBGET integrated database retrieval system