KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_01605Help
Entry
CLIBASIA_01605    CDS       T00948                                 

Definition
(GenBank) hypothetical protein
Organism
las  Candidatus Liberibacter asiaticus psy62
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPR_1 TPR_2 TPR_11 TPR_8 TPR_17 TPR_12 TPR_16 TPR_9 TPR_19 TPR_6 TPR_10 TPR_15 DUF5113 NARP1 SNAP DUF2225
Motif
Other DBs
NCBI-ProteinID: ACT56909
UniProt: C6XEV7
Position
complement(343577..344473)
Genome map
AA seq 298 aa AA seqDB search
MYLPSWISDKFGCGFLRSSKRRGYYSLLSVLVVSVILLIEGCSSLFPSMGRRVNIDSLTA
VIRAHPSDPEGYNVRGVVYGMNGDFEKALLDFQSALDLNPRYYKVYANRALIRYKMGDVP
MAIRDYGTALKINPDYDVAYIGRGNIYRDERYSDLQKAFADFDRAIQLKTSDGRAWYGRA
LVYQMRGEYEKSIEDFSQAISLYSSISPDYYNGRGISYLATKNYDSALEDFKFAINLDPK
KASFWFNGGMVYEMQGSYANAVKYYKKALSVDSRYYRAKNGILRISQDLSSTVNEVNE
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
ttgtatcttcctagttggatcagcgataagtttggttgtggatttttaaggtcttccaaa
agacgggggtattattcccttctatctgttttagttgttagtgtaatattattgatagaa
ggttgttcttctctttttccgtcgatgggtagacgtgttaacattgattccctaacagcc
gttatacgtgcacatcccagtgatcctgaggggtacaatgtgcgaggtgttgtttatggg
atgaacggagactttgaaaaagcattgctggattttcaaagtgctttggatttgaatcct
cggtattacaaggtatatgcaaatcgtgctctgattcggtataaaatgggggatgtcccc
atggcaatcagagattatggaactgctttaaaaattaatccagattacgatgtggcttac
atagggcggggtaatatttatcgcgatgagcggtatagtgatttacaaaaggcatttgct
gattttgatcgtgcaatacagttgaaaacctctgatggacgtgcatggtatggccgtgct
cttgtataccaaatgcgtggagagtatgagaagtccattgaagatttttctcaagcgata
tcgttgtattcctccatatcgccggactattataatggacggggtatttcttatttggct
accaaaaattatgatagcgccttagaggattttaaatttgccatcaaccttgatcctaaa
aaagctagtttttggttcaatggaggcatggtatacgaaatgcagggttcttatgcgaat
gcagtgaagtattacaaaaaggcattatctgttgattcaagatattatagggcgaaaaat
gggatattaagaataagtcaagacttgagctcaacagtcaatgaggttaatgaataa

DBGET integrated database retrieval system