KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_01615Help
Entry
CLIBASIA_01615    CDS       T00948                                 

Gene name
pdxJ
Definition
(GenBank) pyridoxine 5'-phosphate synthase
  KO
K03474  pyridoxine 5-phosphate synthase [EC:2.6.99.2]
Organism
las  Candidatus Liberibacter asiaticus psy62
Pathway
las00750  Vitamin B6 metabolism
las01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:las00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    CLIBASIA_01615 (pdxJ)
Enzymes [BR:las01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.99  Transferring other nitrogenous groups
    2.6.99.2  pyridoxine 5'-phosphate synthase
     CLIBASIA_01615 (pdxJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PdxJ
Motif
Other DBs
NCBI-ProteinID: ACT56911
UniProt: C6XEV9
Position
345013..345798
Genome map
AA seq 261 aa AA seqDB search
MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI
RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL
TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN
KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF
CFRRACGQHLDNTMRLTHPVK
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgtctactagcgtatctgttaatctgaatgcagttgctgtacttcgcaatcgtcgcaat
ctcccatggccaaacttagtgcatatcgggaaaatcgcacttcaatctggagcttccggc
ttgacggtacacccgcgcccagatcaacgtcatatccggtatacggatttacctgagatt
cgtcgcttgatcgatgaacaatttccaaaagcagaattgaacattgagggataccccaat
gaaacattccttaacttatgcgagcgttacaaacccgagcaaattactcttgtcccggat
gatcctcaccaacttacttctgatcatggatgggattttttacaaaatcaggcactgctt
acaaagactgttgctaggttacataatttaggctctagaatttctcttttcgctgatgga
aatggaaatgaacactctctccaagcagctaaattaacgggcgctgattgcattgaactc
tacactggaccctatggagcatgctataacaatcctcaacaagaaaggattttcctaaac
aaactagccattacagcccaactcgcacagaaaatggacttgcaaatcaatgctggacat
gatcttacaatacaaaatataccaaatttgataaatgctatcccatatatctctgaaatt
tcggtaggtcatgcattcgcggctactgctttagaatgtggtgtaaaagaggcggtgttt
tgttttcgtcgtgcctgtggccaacacctagacaatacaatgcgcttaacccacccagta
aaataa

DBGET integrated database retrieval system