KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_01690Help
Entry
CLIBASIA_01690    CDS       T00948                                 

Gene name
pyrE
Definition
(GenBank) orotidine 5'-phosphate decarboxylase
  KO
K01591  orotidine-5'-phosphate decarboxylase [EC:4.1.1.23]
Organism
las  Candidatus Liberibacter asiaticus psy62
Pathway
las00240  Pyrimidine metabolism
las01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:las00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    CLIBASIA_01690 (pyrE)
Enzymes [BR:las01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.23  orotidine-5'-phosphate decarboxylase
     CLIBASIA_01690 (pyrE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OMPdecase ThiG
Motif
Other DBs
NCBI-ProteinID: ACT56926
UniProt: C6XEX4
Position
complement(369502..370218)
Genome map
AA seq 238 aa AA seqDB search
MDAGLIIDVDEKKRLVVGLDLPTVKEAERIVSILSDTVSFYKIGYHLSFSGGLELARDLI
SDGKSVFLDMKLFDIGSSVTAAIEHIANMGVAMLTVHAYPQTMRSAVSVVRDTGICLLAV
TVLTSMDDFDLRESGYEKDISDMVRMRAVQARDIGMGGIVCSPQEVRMVREIVGHNMVIV
TPGIRMLGSATDGQKRFATPETALKYGASHIVVSRPIVRAADPVSAAQEFQRAISLIS
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atggatgctggattaatcattgatgttgacgagaagaagcgtcttgttgttggacttgat
cttccaacggtaaaggaggcagaaagaatcgtgtcaattttgagtgatacggtctccttt
tataaaatagggtatcatttatctttttcaggaggattagagttagcacgtgatttgata
tcagatggcaaaagtgtttttttagatatgaagttatttgatataggaagttctgtcact
gcagctattgagcatatagcaaacatgggagttgccatgttaacagtgcatgcatatcct
caaactatgcgttcggctgtgagtgttgtgcgagatacaggtatttgcttgcttgctgtg
accgtattgacttcaatggatgattttgatctcagagaatcgggttatgaaaaagatatc
tctgatatggtgagaatgcgtgcagttcaagcacgtgatataggaatgggtggaatagtg
tgttctcctcaagaggtacggatggtacgagaaatagtaggtcataatatggttattgtg
actcctggtattaggatgctagggagtgcaacagatggtcagaaaagatttgcgactccg
gaaacagcgttgaaatatggtgctagccatatagttgtttctcgtcctatcgtgagggct
gcagatccagtatccgcagctcaagagtttcaacgtgctatttctttaatttcgtga

DBGET integrated database retrieval system