KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_01705Help
Entry
CLIBASIA_01705    CDS       T00948                                 

Gene name
rpsA
Definition
(GenBank) 30S ribosomal protein S1
  KO
K02945  small subunit ribosomal protein S1
Organism
las  Candidatus Liberibacter asiaticus psy62
Pathway
las03010  Ribosome
Brite
KEGG Orthology (KO) [BR:las00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    CLIBASIA_01705 (rpsA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:las03011]
    CLIBASIA_01705 (rpsA)
Ribosome [BR:las03011]
 Ribosomal proteins
  Bacteria
   Small subunit
    CLIBASIA_01705 (rpsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: S1 PCB_OB S1_2 RuvA_N
Motif
Other DBs
NCBI-ProteinID: ACT56929
UniProt: C6XEX7
Position
complement(373449..375179)
Genome map
AA seq 576 aa AA seqDB search
MSFTNPSREDFATLLEESFTKKDLAENCVTKGIVVGLEKDTVVVDVGLKFEGRIPRREFM
GKGQYTPIKVGDEVEVYVERTENSFGEAVFSRDKALREGVWEKIEAKFRAGERIEGVIFN
QVKGGMTVDLNGEVAFLPRSQIDIRPVRDVTPLMHEPQLFEILKMDKRRGNIVVSRRAVL
EESRAEQRSEIVQKLEEGQVIEGTVKNITDYGVFVDLSGVDGLLHVTDIAWHRILHPSKV
LSIGQQVKVKIIRINQETHRISLGMKQLEKNPWDDVQDKYVEGSKVSGVVTNLTDYGVFV
ELQSGIEGLAHISQISWTKKNIHPSKILSVGQQVEVVILEVNPARKRISLGLKQALINPW
EEFSKSHPPGTEVEGEVKNKTDFGLFIGLDEHLDGMIHLSDLDWNRPGEKVIAEYAKGDI
VKAVVLDIDVGKERISLGVKQLSGSAPDVVDSVSSLRKNDVVSCEVISVSEGGIEVSLID
HKGINSFIRRSDLSRDRVDQDPGRFSKGQIVDACVVNVSKKDGKVSLSIKALEIAEEKGA
VAQFGSSDSGASLGDILGMALKNRGNDAGDSNDNQG
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atgtcttttaccaatccgtcccgcgaggattttgctacccttcttgaggagagctttact
aagaaggatcttgctgagaattgtgtaactaagggtatcgttgtaggcctagagaaggat
actgtagttgttgatgtagggctcaaatttgaggggcgtattcctcgaagggagttcatg
gggaaagggcagtatactcctatcaaggttggcgatgaagttgaagtgtatgttgaacgc
acagagaattcttttggagaggctgttttctctcgagataaagcattgcgtgaaggggta
tgggaaaaaatagaagccaaatttcgggctggagagagaatcgaaggtgtgatatttaac
caagttaaaggtggaatgactgttgatcttaatggagaagtggcttttttgccgcgttcg
cagatagatattcgcccagttagagatgttactcctctcatgcatgaacctcagcttttt
gagattttgaagatggataaaagacgtgggaatatcgttgtttcccgacgtgcagtccta
gaggaatcacgcgccgaacagcgttctgagatagtccagaagcttgaagaggggcaggtt
atcgaaggtactgtcaagaatattacggattatggcgtatttgtggatttgtctggcgtt
gatggtttgttacatgttactgatatagcatggcatcgtattcttcatccttcaaaagtt
ttaagtataggacagcaagttaaagtaaagattatacggattaatcaggaaacacatcga
atatctctggggatgaaacaattagaaaaaaatccttgggatgatgttcaggataagtat
gttgaagggagtaaggtttcgggtgttgttacaaaccttacagattatggagtgtttgtc
gaattgcaatctggtattgagggattagctcatatttctcaaatatcttggacgaagaag
aacattcatcctagcaagattctttccgttgggcagcaagttgaggttgttattttggaa
gttaatcctgctagaaagcgcatctctctcgggttaaagcaagcccttattaatccttgg
gaagagttttccaaaagtcatccgcctggtacggaggttgagggtgaagttaaaaacaag
actgattttggattatttattggtctagacgaacatttagatgggatgatacacctttct
gatcttgattggaatcgtccaggggaaaaggtgattgcagagtatgctaaaggagatatc
gttaaagcggttgttctagatattgacgttggaaaagagcgtatatctttaggggtgaaa
cagctcagtggctctgctccggacgttgtcgattctgtgagtagcttgcggaagaatgat
gtcgtatcgtgtgaagtaatttctgttagtgaaggtggtatagaagtttctcttattgat
cacaagggtattaattcctttatacgtcgttctgatttatcgcgtgatcgtgtagatcag
gatcctggacgtttttccaaagggcaaatagtagacgcttgcgttgtcaatgtctctaag
aaggatggaaaagtttctttgtctatcaaagctttggaaatagcagaagagaaaggtgct
gttgcacaatttggttcttcagattcaggagcatcgctaggtgatatactgggtatggct
cttaagaatcgtgggaatgatgctggcgattccaatgataatcagggatag

DBGET integrated database retrieval system