KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_01715Help
Entry
CLIBASIA_01715    CDS       T00948                                 

Gene name
aroA
Definition
(GenBank) 3-phosphoshikimate 1-carboxyvinyltransferase
  KO
K00800  3-phosphoshikimate 1-carboxyvinyltransferase [EC:2.5.1.19]
Organism
las  Candidatus Liberibacter asiaticus psy62
Pathway
las00400  Phenylalanine, tyrosine and tryptophan biosynthesis
las01100  Metabolic pathways
las01110  Biosynthesis of secondary metabolites
las01130  Biosynthesis of antibiotics
las01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:las00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CLIBASIA_01715 (aroA)
Enzymes [BR:las01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.19  3-phosphoshikimate 1-carboxyvinyltransferase
     CLIBASIA_01715 (aroA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EPSP_synthase
Motif
Other DBs
NCBI-ProteinID: ACT56931
UniProt: C6XEX9
Position
complement(375960..377309)
Genome map
AA seq 449 aa AA seqDB search
MSFVCKKSTIQSSYSCGLQGTICIPGDRSLSHFSIILGGIAAGETQIRGVLESDDVLNTM
RMMHYLGARFTKKDREWIVQGVGNGCLLSPEYPLDFKGFDMGYGLMMGVVGVYDFQTFFK
GRAEILQPTIESLLAPLYQMGVQVKLPEDKRLPLVLHGPRTPNPIVYKSPMDSVQSKSVV
LLAGLNTPGITEVIEPVKTQDHMEIILKEFGVDLLIKSDTIEDYSVRIEGRKRISGCNLK
IPGDSSIAFFPLAAALLIPGSDIKLLNVLTNPLRVGIIDILREMGADITLSNSRIESGEN
IADIRVRFSKIKGITISDNRLRSIVDEYPILLVISAFAEGETIIKGLAEVMTSKQFSGII
ECFNINNIQYEREGDYLMIKGVPGGKGLGCSTGHMVQSKFGYRVAMSFLVMGLASEYSVV
VDDYTMISTIFPDFINLMKTLGARIEWVD
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgtcatttgtttgtaaaaaaagtacgattcaatcatcttattcatgtggtcttcaggga
actatttgcattccaggagataggtctctttcacatttttctatcatattagggggcatt
gctgcaggagagacgcagataaggggggtgttggaaagcgatgatgtgctcaatacaatg
agaatgatgcattatttaggagcacgttttactaaaaaagacagagaatggattgtccaa
ggtgtaggcaatggatgtttgttatccccagaatatccattagattttaaaggcttcgat
atgggatatggactcatgatgggagttgtcggcgtatatgattttcaaactttttttaag
ggaagggcagaaattttacagccgacaatcgaatctctcttagcccctttatatcagatg
ggagttcaggtaaaacttcctgaagataagcgtcttccattggttttgcatggtccaaga
acaccaaatccaattgtatataaatctcctatggattcagtgcaatcgaaatcggttgtt
ttattagcaggactcaatactcccggcattaccgaagttatagagcctgtaaagacacaa
gatcatatggaaattatcctcaaagaatttggagtcgatttattaatcaagtccgatacc
attgaagattattcagttcgaatagaaggaagaaaaaggatttcaggatgtaatttaaaa
ataccaggagattcttctattgcttttttcccattagccgctgctttattgattcctgga
tctgatataaagcttttaaatgtgttaactaatccattgcgagttggaataattgacatc
ttgcgagaaatgggagcggatattactctctcaaattctcgcattgagagtggtgaaaat
attgctgacattcgagtccgtttttccaagatcaaagggattacgatatccgataatcgt
ttacgatctatagtagatgaatatcctattttattggtgatttctgcttttgccgaagga
gaaacgattataaaggggctggcagaggtaatgacatccaagcaattctctgggattatc
gaatgcttcaatattaataatattcaatatgaaagagagggggattatctcatgattaaa
ggagtccctggaggtaagggattgggatgtagtacagggcatatggtgcaatcaaagttt
ggttatcgtgtagcaatgagctttcttgttatggggcttgcatcggaatattcggttgtt
gttgacgattatactatgatctctactatttttccagattttataaacttaatgaagact
ttaggcgctaggattgaatgggtagattag

DBGET integrated database retrieval system