KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_01730Help
Entry
CLIBASIA_01730    CDS       T00948                                 

Gene name
fabB
Definition
(GenBank) 3-oxoacyl-(acyl carrier protein) synthase I
  KO
K00647  3-oxoacyl-[acyl-carrier-protein] synthase I [EC:2.3.1.41]
Organism
las  Candidatus Liberibacter asiaticus psy62
Pathway
las00061  Fatty acid biosynthesis
las00780  Biotin metabolism
las01100  Metabolic pathways
las01212  Fatty acid metabolism
Module
las_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:las00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CLIBASIA_01730 (fabB)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    CLIBASIA_01730 (fabB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:las01004]
    CLIBASIA_01730 (fabB)
Enzymes [BR:las01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.41  beta-ketoacyl-[acyl-carrier-protein] synthase I
     CLIBASIA_01730 (fabB)
Lipid biosynthesis proteins [BR:las01004]
 Fatty acid synthase
  Component type
   CLIBASIA_01730 (fabB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Ketoacyl-synt_C Thiolase_N KAsynt_C_assoc Lipase_3
Motif
Other DBs
NCBI-ProteinID: ACT56934
UniProt: C6XEY2
Position
379126..380346
Genome map
AA seq 406 aa AA seqDB search
MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI
DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR
EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK
QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE
EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA
TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI
EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgagacgggtagctgttacaggaatggggattgtgtcttccatagggaataatgtttct
gaggtggcgatttcgttgcgagaagcaagatctggcattacattctcagaagattttgcg
aaatttggctttcgttgccaagtatgggggaaaccccttcttaatgcagcagagttgatt
gaccgaaaagccatgcgttttctatcacagggaggaacgtgggggcatctcgctatgcaa
gaagcgattaccgattcccgcctgcaaccgtgtgaaataactcatgaaaggacagggtta
attgctggatcaggtgggccttctacgaaatgcattgttagtgccgctgatcttactcgc
gaacattgtagtactcggcgtataggtccatttgcagtacctaaagcaatgtcatctacg
gcatctgccactttgtcaacttggtttaaaatacgcggaactagctattcaatttcttca
gcttgcgctacttctgcccattgcatcgggaatgctgcagaattaattcaatctgggaaa
caagatataatgtttgcagggggacaagaagatcttgattggacgatgtctaatcttttt
gatgcaatgggcgccatgtcgtcacatttcaatcacgatccttgttctgcctctagacca
tatgattctagacgcgatggatttgtaatatctggcggagcagcagtcattgttctggag
gaaatggaacgagctaaagcacgtggtgcaaaaatttatgctgaattaactgggtatggc
agtacgtgtgatggcgacgatatggtgtctccttctggagaaggagctatacgttgcatg
cgtcaggctttaagctcagtggaagagcccgtcgattatattaatactcatggaacagca
actcctaaaggagataaaaaggaagtagaggctattagagaggtatttaaaggtaatatt
ccatatatccaatcaacgaagtctctaactggacattcgttaggcgctgcaggagctcaa
gaggcaatctattgtttaataatgatgcaagagaggtttatcggagaaagtaaaaatatt
gaggaaatcgatcctgaatttaaaggaatcccaatagttcgaaaacgcattgataatgca
aaaattgatacggttctgtccaattcttttggattcggtggaacaaatgcaactcttgtc
tttcgccgatataaaggatga

DBGET integrated database retrieval system