KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_01740Help
Entry
CLIBASIA_01740    CDS       T00948                                 

Definition
(GenBank) putative peptidoglycan binding protein
Organism
las  Candidatus Liberibacter asiaticus psy62
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Apolipoprotein TMEM95 Tsi6 Laminin_II DUF5618 OTU
Motif
Other DBs
NCBI-ProteinID: ACT56936
UniProt: C6XEY4
Position
381619..383640
Genome map
AA seq 673 aa AA seqDB search
MSGLTPLKDHSSCAVSKKSELENPSGMTDIHRIKNWIQKVIGEEKNKPLSQEQKEKIKIL
WSSLRKIAGSNEEVSDPNLNSPIQREDDCNVVRTNDDTKQIFNLLRKKLSNPHLQQHIES
KTEQNGGIDPNLQSESLPTIPGTAIREDDDIDIFHSDMAKLSKSITELCRIISIPGIKKS
HSQLEKILSKMENIAKECSLQSVENNWKGALQHFKKLDFKNLHEKINTLSCQMNVMQCTF
DKNNNGFAASGIDEKLVSIVNSTHNLLSLLKLLNEKISTKGVLSFDTKLSEIKTAVEKNR
KYAQSYTQKFVEKFEKHLESIGAQVQDIHSDVREQQKPAKPRLDLIEKIGERLGNLESHV
ANIMLKLEERQNTSEDPAILRNLENQLLNIKDLVTNDLKDNRTLREPDQHVFGLEDYIVK
TAHKTARSMLNSINKSQDIERILQKNMHEYCKEIQKVHAEQTIKNFTTLYDMLVKIFQKL
GTLTEEGRRLPYSTSNDLSPNHQASHKYSELFKNLCSDNTPSVNQTRVESNTYNEQYPIL
SSNNSLDQHNHPHDISETQGDSVYDQKKREKEFNSPHDIQHMLERVSLIQQGILEDDNTI
PTYISAVRRATSTSTMRSNDLKEKNIGKKIWNFTKYITSNQWVTSIMLVATLLVSSFLLS
PALLVRETFFFKS
NT seq 2022 nt NT seq  +upstreamnt  +downstreamnt
atgagtggattaacacccttaaaagatcattctagttgtgcggtatctaaaaaatcagaa
ttagagaacccttctggtatgacagacattcatcgtattaaaaattggatccaaaaagtt
ataggggaagagaaaaacaagcctttaagtcaagaacaaaaagaaaaaataaagattttg
tggtcctcgttaagaaaaattgccggtagcaatgaagaagtgagtgatcccaacttgaat
tcccctatccagagagaagatgattgcaatgtagtaaggacaaatgatgatactaagcaa
atatttaatcttttgagaaaaaagctttccaatcctcatctgcaacaacatattgaaagc
aaaacagaacaaaacggaggtatagatcctaacctacaatcagaatccctccctaccatc
cctggtactgcaatacgagaagatgatgatatagacatttttcattctgatatggctaag
ctatcaaaaagtataactgaattatgccgtattatatctattccagggataaaaaaatct
cattcccaacttgaaaaaatactttccaaaatggaaaatattgcaaaagagtgttctcta
cagagtgtagaaaataattggaaaggtgctctacaacactttaaaaaattggatttcaaa
aatcttcacgaaaaaattaatactctctcctgccaaatgaatgttatgcagtgcactttt
gataaaaacaacaatggattcgcagcatccggtattgatgaaaagctggtatctattgta
aatagtactcataatcttttatcgttactgaagcttttgaatgaaaaaatatcaacaaaa
ggtgtattatcattcgataccaaactatcggaaatcaaaactgctgtcgaaaaaaataga
aaatatgcccagtcttatacccaaaaatttgttgaaaaattcgaaaaacacttagaaagt
attggcgcgcaagttcaggatatacacagcgacgttagagagcagcaaaaacctgcgaaa
ccaagattagacctcattgaaaaaatcggtgaacgtcttggcaatttggaatcccatgtt
gcaaatatcatgctaaagttggaggaaaggcaaaatacttcagaagatcccgccatttta
cgtaatttagaaaatcaacttcttaatatcaaagatcttgtaacaaacgatttgaaagat
aataggacacttcgggaacctgatcagcatgtttttggtctagaggattatatcgttaaa
actgcccataaaacagctagatcgatgttgaattcaatcaataaaagtcaagatatagaa
cgaatcttacaaaaaaatatgcatgaatattgtaaagaaatacagaaagtacatgcagaa
caaacaatcaaaaacttcactacactttatgacatgcttgtgaaaattttccaaaaatta
ggaactctcacagaagaaggacgcagattaccttactctacctctaatgatttgtctcca
aaccatcaggcgtcgcacaaatattccgaactcttcaaaaatctctgtagtgataatact
ccatcagtaaatcaaaccagagttgaatcgaacacatataatgaacaatatccaatatta
tcttccaacaactctttagatcaacataatcacccgcacgacatctcagaaacacaaggc
gattcggtttatgatcaaaaaaaacgagaaaaagagttcaatagtcctcatgacatacaa
catatgttggagagagtatccctaatacagcagggaattttagaagacgataacacaatt
cctacttatatctctgctgtaagacgagcaacatcgacatcaactatgcggagtaatgat
ctcaaagaaaaaaatatagggaagaaaatatggaatttcactaagtatatcacctctaac
cagtgggttacatctatcatgttagtagcaacgttactagtttcttcatttttattatcc
cctgctttattggttagggaaacatttttctttaaaagttaa

DBGET integrated database retrieval system