KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_01790Help
Entry
CLIBASIA_01790    CDS       T00948                                 

Gene name
cyoB
Definition
(GenBank) cytochrome O ubiquinol oxidase subunit I
  KO
K02298  cytochrome o ubiquinol oxidase subunit I [EC:7.1.1.3]
Organism
las  Candidatus Liberibacter asiaticus psy62
Pathway
las00190  Oxidative phosphorylation
las01100  Metabolic pathways
Module
las_M00417  Cytochrome o ubiquinol oxidase
Brite
KEGG Orthology (KO) [BR:las00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CLIBASIA_01790 (cyoB)
Enzymes [BR:las01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.3  ubiquinol oxidase (H+-transporting)
     CLIBASIA_01790 (cyoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: COX1
Motif
Other DBs
NCBI-ProteinID: ACT56946
UniProt: C6XEZ4
Position
complement(394602..396617)
Genome map
AA seq 671 aa AA seqDB search
MLQNIDFHKFIFGRLTINSIPYNIPIVLGTFFVVALVGVSIIFAITYYRLWGYLWKEWFT
SVDHKKIGIMYIILSLVMLFRGFADAIMMRLQQAIASGGGEGYLDAHHYDQIFTAHGVIM
IFFVAMPMITGIMNFVVPLQIGARDVSFPFLNNFSFWMTVAGAVVIMCSLFIGEFASVGW
LAYPPLSGISYSPGVGVDYYIWGLQIAGIGTTLSGINLVVTIIKMRCPGMTMMKMPVFVW
TAFCSNIMIIAAFPILTATLFLLTLDRYIGTNFFTNHLGGNPMMYINLIWIWGHPEVYIL
VLPAFGIFSEVVATFSGKRLFGYNSMVYATLAITILSYTVWLHHFFTMGSGANVNAFFGI
MTMVIAVPTGAKIFNWLFTMRLGKVRFEVPMMWTLGFMITFLIGGMTGVLLAVPPADFTL
HNSLFLVAHFHNTIIGGVVFGLFAGIVYWFPKAFGYQLNSFWGKVSFWCWFVGFYLAFMP
LYALGLKGVTRRLSQYEDTTLQVYYVVALLGAVLIGIGVFSFVLSFIVSFLNRSKLQDTI
GDPWDGRTLEWSISSPSPQYNFAFTPIVSTIDAWEHMKNRGYRYPSEGFMPIHMPSNTAT
GIILAALSIVFSFAMVWYMWWLALLSFISIVFYTIFHTFNYNDGYEVSAKDVAFSEEVHR
KMNMPKDREHC
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
atgctacaaaacattgatttccataagttcatatttggacgtttaacgattaattccatt
ccttataacatccctatagtattggggacattttttgtggtggctttagtaggcgtatct
attattttcgctattacatactatcgtctttggggttacttgtggaaagaatggtttaca
agtgttgatcataaaaaaataggtattatgtatataatactgtctttggtgatgcttttt
cgaggttttgcggatgctataatgatgcgtcttcagcaagctatagcatctggcggggga
gaaggatatctggatgctcatcactatgatcagatatttacagctcatggtgtgattatg
atttttttcgtggctatgcccatgatcacaggcatcatgaattttgtagttccattgcaa
ataggtgctcgagacgtttctttcccttttttgaataatttttcgttttggatgactgtt
gcgggcgcagtagttataatgtgctctttatttataggcgaatttgcttctgtaggttgg
ttagcatatcctccgttatctggaatatcgtactctcctggagttggagttgattattat
atttggggattacaaattgcggggatcggaacgactttatccggaataaatttagtagtg
actatcataaagatgcgttgtccaggaatgacgatgatgaagatgccagtattcgtttgg
actgctttttgttctaatataatgattatagctgcgtttcctattttaacagccacactt
ttcttgttaacacttgatcgttatataggtactaatttttttactaaccatcttggtggt
aatccaatgatgtatattaatttgatttggatatggggacatccagaagtgtatatactc
gtattaccggcttttgggattttttctgaagttgttgcaactttttcgggaaagagactg
tttggatataattccatggtttatgcgacgttagcaataacaatcttgtcgtatactgtt
tggttacatcatttctttaccatgggttctggggctaatgtgaatgctttctttggaatc
atgacaatggttatagcagtgcctacgggggctaaaattttcaattggctctttacaatg
cgtttaggaaaagtgcgttttgaagttccgatgatgtggactttaggttttatgataact
tttttgatagggggtatgacaggggtattgctcgctgttcctccagcggattttacgctg
cacaattcattgtttttggttgctcactttcataatactataattggaggtgttgttttt
ggtttgtttgcggggatcgtttattggtttcctaaggcttttggttatcaactcaattct
ttttggggaaaggtttctttttggtgttggtttgtcggtttttacctagcgtttatgccg
ctttatgcccttggattaaaaggtgtgactcgtcgattaagtcaatatgaagatactact
ttgcaagtttactatgttgtagcgttgttaggagctgtacttataggaattggggtgttt
tcttttgttttatcatttattgtctccttcttaaatagatctaaattacaggatacgatt
ggggatccatgggatggacgtaccttggagtggtctatctcttctcctagtccacagtat
aattttgcttttactcctatcgtatctacaatagatgcttgggaacatatgaagaatcgt
ggatatcgctatccatccgaaggttttatgccaattcatatgccgtcaaatactgctacg
ggtattattttggcagcgttgagtattgttttttcctttgcgatggtatggtatatgtgg
tggctagcacttctctcttttatatcaattgttttctatacgatatttcatacatttaat
tataatgacggatatgaagtttctgcgaaagatgtggcattttctgaagaagttcataga
aaaatgaacatgccaaaagacagggagcattgttaa

DBGET integrated database retrieval system