KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_01840Help
Entry
CLIBASIA_01840    CDS       T00948                                 

Definition
(GenBank) putative inner membrane protein translocase component YidC
  KO
K03217  YidC/Oxa1 family membrane protein insertase
Organism
las  Candidatus Liberibacter asiaticus psy62
Pathway
las02024  Quorum sensing
las03060  Protein export
las03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:las00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    CLIBASIA_01840
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    CLIBASIA_01840
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    CLIBASIA_01840
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:las03029]
    CLIBASIA_01840
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:las02044]
    CLIBASIA_01840
Mitochondrial biogenesis [BR:las03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-IV assembly factors
    CLIBASIA_01840
Secretion system [BR:las02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   CLIBASIA_01840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YidC_periplas 60KD_IMP
Motif
Other DBs
NCBI-ProteinID: ACT56956
UniProt: C6XF04
Position
403720..405465
Genome map
AA seq 581 aa AA seqDB search
MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDD
RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAY
FAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYLF
KIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEKS
SISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPGK
SITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNF
GIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYK
THNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGIL
PFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLII
YWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKNYNSQ
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atggaaagaaattggaactattttgtagctatcgccctatctgttatcattgtatacgct
tggcaaaatttttacgtctatcctcgcattgaggaaatgaacaacgaacgcaaaaatatt
caaacagtaaaacaaccgaatcaagttgataattcgtatgctgctgtattgatagatgat
cgtgcgcaagctttatctatgtctccccgcgttgagcttaaaaatccttctctcattgga
tcaattaatctaaaaggcgctcagtttgatgatctaaacttacgaggctatcatttagat
gtgtctagcaacagccctattgtcacacttttaagcccatcaaatacaaaaaatgcctat
tttgccgaattagattatgtgtccacagccaataacatagagttgccaaattcaaatact
gtctggaacttgatttctggcaaaatcctcacccctactactccaataaaattggttttt
aaaaatgcaaacaatattttatttgagcgcacgatatcattggatgagcattacctcttt
aagatagtagatacagttacaaacaatagcatagatcagatcagattttctccgcgtggg
cgaattatgcgccataaaccacaaacggcaaccaatacctttggagtacaagaaggattt
atagctgttttaggggacaaatcccttgtagaacagaagtattctgatattgaaaaatct
agcatttctaatttccacgaatctaacagttggctcggaatatcagacaagtattgggca
tctgttttcataccatctaaagaaacatcatttcatagccaattcaaatatttgtctgat
ggacacgctcgttatcaagcaaaatttagcgccaatgaaattactattcttcctggaaaa
tcaatcacaacaacaaattttctatttgcaggcgctaaagagtttcccacgattcatcac
tacgaaaaggatttggcaattccgcggtttgaaatgctgattgattggggttggttttac
tttattgcgaaacccatgtttatgcttatgagttatttttataacctcgtagggaacttt
ggtattgcaattatgctaacaacagtttttgtcaagcttctgttctttccattagcaaaa
aagcaatatgtctctacggctaatatgaaaaatattcaaccaaaaatagatgaattacgc
gagaaatttaaacaatcccctcctcaagtattgcaaaaagcaatgattcaactatacaag
acacacaacattaatcctcttgcagggtgttggcccatattattgcaaattccagtattt
ttcgctatctacaaagttatttctatatctttagaaatgagacatgctcctttttgggga
tggattaaagatctcgctgcagctgatccgaccaatatttttacactatttggaatattg
ccgttttatctccctggattcatgcatgttggtatctggccaataattatgagtctatcc
atgtttattcagatgaaaatgagtccacctcctgcagataaaggacaagcaatgatttta
aactggatgcccgtagtatttgtttttgccctgtcttctttccctgctggattgattata
tattggtcttggagcaatgttatatccattgtccaacaagcagtaatcatgaaaatgcat
ggtgcagaaattggactgatagataggttgcgttctacgttttcgaaaaactataattct
caataa

DBGET integrated database retrieval system