KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_01880Help
Entry
CLIBASIA_01880    CDS       T00948                                 

Definition
(GenBank) 3-oxoacyl-(acyl carrier protein) synthase II
  KO
K00648  3-oxoacyl-[acyl-carrier-protein] synthase III [EC:2.3.1.180]
Organism
las  Candidatus Liberibacter asiaticus psy62
Pathway
las00061  Fatty acid biosynthesis
las01100  Metabolic pathways
las01212  Fatty acid metabolism
Module
las_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:las00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CLIBASIA_01880
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:las01004]
    CLIBASIA_01880
Enzymes [BR:las01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.180  beta-ketoacyl-[acyl-carrier-protein] synthase III
     CLIBASIA_01880
Lipid biosynthesis proteins [BR:las01004]
 Fatty acid synthase
  Component type
   CLIBASIA_01880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACP_syn_III ACP_syn_III_C Suv3_N
Motif
Other DBs
NCBI-ProteinID: ACT56962
UniProt: C6XF10
Position
411579..412556
Genome map
AA seq 325 aa AA seqDB search
MIKSSSCILGFGHAVPNQCIHNSIIERHLNLKLGVIEQKTGIKYRYWAEKHETLTDIAIQ
AGDIALRNANIKKDSISLTLLATSTPDHLLPPSSPLITHRLGLMQSGAIDLTGACAGFLY
ALVMADSYINSHQKPVLIIAANLLSRRINLEDKDTAIIFGDAAGAVVLAPSPLKDKSGIL
GIELTSDGSKYDLIKIPTGGSTSPAGTNTHDFYMRITNGADIFYNAVKIMAQSAKQSLRK
SDLQPQDINRFIPHQANSRIIQKVCEKIGLSKRIMVNSLKDFGNSSSASIPLSLSLENQR
KPFQKGEKILTISCRRGNDRGIYCL
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
ttgataaaaagttctagctgcattctcggattcggacatgctgttcctaaccaatgcatt
cataattctataattgaaagacacctaaatcttaagctaggtgttatagaacaaaaaact
ggtattaaatatcgatattgggctgaaaaacacgaaacactaactgatattgcaatacaa
gcaggagatatagctttacgaaatgctaatatcaaaaaggatagcatttctttaacactt
cttgctacttcaacacctgatcacttattaccaccatcttctcctctcatcactcatcgc
ttgggacttatgcaatctggagctattgatctaacaggagcatgtgcaggttttctttat
gcactcgtaatggctgatagctatatcaattcacatcaaaaacccgttcttattattgca
gctaatctccttagtagacgtattaatttagaagacaaggatacagctatcatttttgga
gatgctgcaggagctgttgtacttgcgccatcgccattgaaagataaaagtggtatcctt
ggaattgaactcacttcagatggtagcaagtatgatctcatcaaaatcccaacagggggt
agtacttctcctgctggaacaaatacgcacgatttttatatgcgtattactaatggagca
gatatcttttataatgcagtaaaaataatggcccaatccgcaaaacaatcattaagaaaa
tccgatcttcaaccccaagatattaatcgttttattccacatcaagctaacagccgaatt
attcaaaaagtttgcgaaaaaatcggtttgtctaaaaggataatggtaaattccctcaaa
gatttcgggaattcatcatcagctagtattcctctttcactatctttggaaaatcaaaga
aaaccttttcaaaaaggagaaaaaattttaactatcagctgcaggcgcgggaatgatagg
gggatctattgtctttag

DBGET integrated database retrieval system