KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_01920Help
Entry
CLIBASIA_01920    CDS       T00948                                 

Gene name
fabH
Definition
(GenBank) 3-oxoacyl-(acyl carrier protein) synthase III
  KO
K00648  3-oxoacyl-[acyl-carrier-protein] synthase III [EC:2.3.1.180]
Organism
las  Candidatus Liberibacter asiaticus psy62
Pathway
las00061  Fatty acid biosynthesis
las01100  Metabolic pathways
las01212  Fatty acid metabolism
Module
las_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:las00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CLIBASIA_01920 (fabH)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:las01004]
    CLIBASIA_01920 (fabH)
Enzymes [BR:las01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.180  beta-ketoacyl-[acyl-carrier-protein] synthase III
     CLIBASIA_01920 (fabH)
Lipid biosynthesis proteins [BR:las01004]
 Fatty acid synthase
  Component type
   CLIBASIA_01920 (fabH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACP_syn_III_C ACP_syn_III Thiolase_N FAE1_CUT1_RppA
Motif
Other DBs
NCBI-ProteinID: ACT56970
UniProt: C6XF18
Position
780379..781353
Genome map
AA seq 324 aa AA seqDB search
MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA
RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV
TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT
GILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHL
TIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRV
KKGDCLLLEAMGGGFTSGTVLLRW
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
gtgattcgttctaccgtacgagggattggtttatctcttcctcggagggtgttgtctaat
tctgatttagagagtattgtagatacctccgatggttggattaaaaggcgtgttggtatc
agtcgacggcatatcgctggaaaagatgagacaactgcttctcttggagaggcggctgcg
cgtgatgcattgcatcatgcggaaatgagtgtagacgatattgatttaataattgtagct
acgtcgactccagatcagactttcccttcgactgctgtcaatattcagaatcgtttggga
atgaagcgcggttttgcctttgacatgcaggctgtttgttctggattcgtttatgcagtg
actacagcagattcatatatacgctcaggagttgtgcgacgtgttatggtaataggatct
gatacgttctcgcgtattgttgactggtctgatcgctctacttgtgttttgtttggcgat
ggtgctggggctttgattcttgagggagtggaagtgaaaggctctagtatggctgataca
ggtatcttatcaacgtatttatgttctgatggttcttatattgacaagttatacgtagat
ggtgggccttctacttctagaactgtgggttgtattcgtatggaaggaaaggcggttttt
aagtatgcggtggaaaaggccgtggaattgatagaaaaagtttttgattctactcatttg
acaattgaaaatattgattggtttgttccacatcaagctaattggcgtattatcaatagt
atagtagacaagatgaagattccttttgataaagtaattgttacggtggatatacatggc
aatacttctgctgcttctattccccttgctttagctgtagcggtgaaagaagggcgtgtt
aaaaagggggattgccttttgttggaagcaatgggcggaggatttacttcggggactgta
ctattacgatggtag

DBGET integrated database retrieval system